BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30706 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ697721-1|CAG26914.1| 135|Anopheles gambiae putative odorant-b... 50 6e-08 AY146733-1|AAO12093.1| 131|Anopheles gambiae odorant-binding pr... 41 2e-05 AJ697724-1|CAG26917.1| 131|Anopheles gambiae putative odorant-b... 41 2e-05 AY146728-1|AAO12088.1| 131|Anopheles gambiae odorant-binding pr... 40 5e-05 AY146734-1|AAO12094.1| 176|Anopheles gambiae odorant-binding pr... 40 7e-05 AY146740-1|AAO12100.1| 139|Anopheles gambiae odorant-binding pr... 39 1e-04 AY146735-1|AAO12095.1| 149|Anopheles gambiae odorant-binding pr... 38 3e-04 AY146745-1|AAO12105.1| 153|Anopheles gambiae odorant-binding pr... 36 8e-04 AJ697725-1|CAG26918.1| 153|Anopheles gambiae putative odorant-b... 36 8e-04 AF437886-1|AAL84181.1| 153|Anopheles gambiae odorant binding pr... 36 8e-04 AY604021-1|AAT38515.1| 118|Anopheles gambiae LZ9988P protein. 34 0.003 AY146729-1|AAO12089.1| 156|Anopheles gambiae odorant-binding pr... 34 0.003 AF437888-1|AAL84183.1| 154|Anopheles gambiae odorant binding pr... 34 0.003 AY146724-1|AAO12084.1| 151|Anopheles gambiae odorant-binding pr... 33 0.006 AY146723-1|AAO12083.1| 155|Anopheles gambiae odorant-binding pr... 32 0.010 AY146721-1|AAO12081.1| 144|Anopheles gambiae odorant-binding pr... 32 0.010 AF437884-1|AAL84179.1| 144|Anopheles gambiae odorant binding pr... 32 0.010 AY146742-1|AAO12102.1| 154|Anopheles gambiae odorant-binding pr... 31 0.017 AF437890-1|AAL84185.1| 154|Anopheles gambiae odorant binding pr... 31 0.017 AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding pr... 31 0.017 AY146722-1|AAO12082.1| 107|Anopheles gambiae odorant-binding pr... 29 0.12 AY146720-1|AAO12080.1| 147|Anopheles gambiae odorant-binding pr... 29 0.12 AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-b... 27 0.38 AY146737-1|AAO12097.1| 119|Anopheles gambiae odorant-binding pr... 25 1.1 AJ697722-1|CAG26915.1| 119|Anopheles gambiae putative odorant-b... 25 1.1 AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding pr... 25 2.0 AY146755-1|AAO12070.1| 320|Anopheles gambiae odorant-binding pr... 25 2.0 AY146754-1|AAO12069.1| 334|Anopheles gambiae odorant-binding pr... 25 2.0 AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding pr... 25 2.0 AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding pr... 25 2.0 AY146747-1|AAO12062.1| 288|Anopheles gambiae odorant-binding pr... 24 3.5 AJ618931-1|CAF02009.1| 288|Anopheles gambiae odorant-binding pr... 24 3.5 AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltr... 23 6.1 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 6.1 >AJ697721-1|CAG26914.1| 135|Anopheles gambiae putative odorant-binding protein OBPjj11 protein. Length = 135 Score = 49.6 bits (113), Expect = 6e-08 Identities = 23/85 (27%), Positives = 46/85 (54%), Gaps = 1/85 (1%) Frame = +1 Query: 1 SVVLICLAFAVFNCGADNVHLTETQKEKAKQYTSECVKESGVSTEVINAAKTGQ-NSEDK 177 ++ + LA A C + +E Q+E A+Q +C++++G S + +N ++G D+ Sbjct: 3 TIACLVLASAFIACAVATI--SEEQREAARQLAGKCMQQTGASEDDVNRLRSGDTEGADR 60 Query: 178 AFKKFVLCFFNKSAILNSDGTLNMD 252 + FV CFF + ++ DG++ D Sbjct: 61 NTRCFVQCFFQGAGFVDQDGSVQTD 85 Score = 33.5 bits (73), Expect = 0.004 Identities = 11/38 (28%), Positives = 23/38 (60%) Frame = +2 Query: 260 RKLPPGVNKSEAQSVLEQCKDKTGQDAADKAFEIFQCY 373 +KL + +A ++ +C++ G DA +++F + QCY Sbjct: 89 QKLASEYGQEKADELVARCRNNDGPDACERSFRLLQCY 126 >AY146733-1|AAO12093.1| 131|Anopheles gambiae odorant-binding protein AgamOBP23 protein. Length = 131 Score = 41.1 bits (92), Expect = 2e-05 Identities = 19/69 (27%), Positives = 37/69 (53%), Gaps = 2/69 (2%) Frame = +1 Query: 52 NVH-LTETQKEKAKQYTSECVKESGVSTEVINAAKTGQ-NSEDKAFKKFVLCFFNKSAIL 225 +VH T Q++ + EC+ E+G+ E + + G + D+ K F+ CFF K + Sbjct: 16 SVHAFTLRQQKMVSIFALECMAETGIGAESLTKLRDGDLTANDRTAKCFMKCFFEKENFM 75 Query: 226 NSDGTLNMD 252 +++G L ++ Sbjct: 76 DAEGKLQLE 84 Score = 26.6 bits (56), Expect = 0.50 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +2 Query: 257 ARKLPPGVNKSEAQSVLEQCKDKTGQDAADKAFEIFQCYY 376 A L +++ +LE+C ++ +DA + AF + CY+ Sbjct: 87 ATALEKDYERAKIDEMLEKCGEQK-EDACETAFNAYACYH 125 >AJ697724-1|CAG26917.1| 131|Anopheles gambiae putative odorant-binding protein OBPjj14 protein. Length = 131 Score = 41.1 bits (92), Expect = 2e-05 Identities = 19/69 (27%), Positives = 37/69 (53%), Gaps = 2/69 (2%) Frame = +1 Query: 52 NVH-LTETQKEKAKQYTSECVKESGVSTEVINAAKTGQ-NSEDKAFKKFVLCFFNKSAIL 225 +VH T Q++ + EC+ E+G+ E + + G + D+ K F+ CFF K + Sbjct: 16 SVHAFTLRQQKMVSIFALECMAETGIGAESLTKLRDGDLTANDRTAKCFMKCFFEKENFM 75 Query: 226 NSDGTLNMD 252 +++G L ++ Sbjct: 76 DAEGKLQLE 84 Score = 26.6 bits (56), Expect = 0.50 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +2 Query: 257 ARKLPPGVNKSEAQSVLEQCKDKTGQDAADKAFEIFQCYY 376 A L +++ +LE+C ++ +DA + AF + CY+ Sbjct: 87 ATALEKDYERAKIDEMLEKCGEQK-EDACETAFNAYACYH 125 >AY146728-1|AAO12088.1| 131|Anopheles gambiae odorant-binding protein AgamOBP21 protein. Length = 131 Score = 39.9 bits (89), Expect = 5e-05 Identities = 15/39 (38%), Positives = 26/39 (66%) Frame = +2 Query: 263 KLPPGVNKSEAQSVLEQCKDKTGQDAADKAFEIFQCYYK 379 KL G ++A++ + C++ G+ A DKAF ++QCY+K Sbjct: 87 KLSKGNPTAKAEAFADVCENNEGETACDKAFSLYQCYHK 125 >AY146734-1|AAO12094.1| 176|Anopheles gambiae odorant-binding protein AgamOBP24 protein. Length = 176 Score = 39.5 bits (88), Expect = 7e-05 Identities = 23/76 (30%), Positives = 33/76 (43%), Gaps = 1/76 (1%) Frame = +1 Query: 31 VFNCGADNVHLTETQKEKAKQYTSECVKESGVSTEVINAAKTGQNSEDKAFKK-FVLCFF 207 VF L + Q ECVKE+G+ + +G S D K FV CF Sbjct: 38 VFPSPLQGARLEAEHVRRIHQNARECVKETGILPKNAFRVLSGDFSVDTMKAKCFVKCFL 97 Query: 208 NKSAILNSDGTLNMDV 255 +K+ ++ DG + DV Sbjct: 98 DKAGFIDDDGVIQQDV 113 >AY146740-1|AAO12100.1| 139|Anopheles gambiae odorant-binding protein AgamOBP9 protein. Length = 139 Score = 38.7 bits (86), Expect = 1e-04 Identities = 17/51 (33%), Positives = 27/51 (52%) Frame = +1 Query: 76 KEKAKQYTSECVKESGVSTEVINAAKTGQNSEDKAFKKFVLCFFNKSAILN 228 +E Y +ECVK GVS E++ K+ ED + ++ C FNK + + Sbjct: 24 REDLLAYRAECVKSLGVSDELVEKYKSWNFPEDDTTQCYIKCIFNKMQLFD 74 >AY146735-1|AAO12095.1| 149|Anopheles gambiae odorant-binding protein AgamOBP25 protein. Length = 149 Score = 37.5 bits (83), Expect = 3e-04 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 2/79 (2%) Frame = +1 Query: 13 ICLAFAVFNCGADNVHLTETQK-EKAKQYTSECVKESGVSTEVINAAKTGQ-NSEDKAFK 186 ICL V A L + K + + EC+ ESG+ + + A + ++ K Sbjct: 13 ICLDALVDGAAAPPPDLEDVSKIANGEAFALECLIESGLKLDSLAALSAKELDTNGSKIK 72 Query: 187 KFVLCFFNKSAILNSDGTL 243 V CFF K+ +N DG L Sbjct: 73 CLVKCFFEKTGFMNKDGQL 91 >AY146745-1|AAO12105.1| 153|Anopheles gambiae odorant-binding protein AgamOBP3 protein. Length = 153 Score = 35.9 bits (79), Expect = 8e-04 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +1 Query: 79 EKAKQYTSECVKESGVSTEVINAAKTGQNSEDKAFKKFVLCFFNKSAILNSDG 237 EK K CV E+G S + I + ED K ++ C F+++ ++N G Sbjct: 45 EKMKPMHDACVAETGASEDAIKRFSDQEIHEDDKLKCYMNCLFHQAGVVNDKG 97 >AJ697725-1|CAG26918.1| 153|Anopheles gambiae putative odorant-binding protein OBPjj15 protein. Length = 153 Score = 35.9 bits (79), Expect = 8e-04 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +1 Query: 79 EKAKQYTSECVKESGVSTEVINAAKTGQNSEDKAFKKFVLCFFNKSAILNSDG 237 EK K CV E+G S + I + ED K ++ C F+++ ++N G Sbjct: 45 EKMKPMHDACVAETGASEDAIKRFSDQEIHEDDKLKCYMNCLFHQAGVVNDKG 97 >AF437886-1|AAL84181.1| 153|Anopheles gambiae odorant binding protein protein. Length = 153 Score = 35.9 bits (79), Expect = 8e-04 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +1 Query: 79 EKAKQYTSECVKESGVSTEVINAAKTGQNSEDKAFKKFVLCFFNKSAILNSDG 237 EK K CV E+G S + I + ED K ++ C F+++ ++N G Sbjct: 45 EKMKPMHDACVAETGASEDAIKRFSDQEIHEDDKLKCYMNCLFHQAGVVNDKG 97 >AY604021-1|AAT38515.1| 118|Anopheles gambiae LZ9988P protein. Length = 118 Score = 33.9 bits (74), Expect = 0.003 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +1 Query: 94 YTSECVKESGVSTEVINAAKTGQ-NSEDKAFKKFVLCFFNKSAILNSDGTL 243 + EC+ ESG+ + + A + ++ K V CFF K+ +N DG L Sbjct: 17 FALECLIESGLKLDSLAALSAKELDTNGSKIKCLVKCFFEKTGFMNKDGQL 67 >AY146729-1|AAO12089.1| 156|Anopheles gambiae odorant-binding protein AgamOBP5 protein. Length = 156 Score = 33.9 bits (74), Expect = 0.003 Identities = 14/50 (28%), Positives = 27/50 (54%) Frame = +1 Query: 100 SECVKESGVSTEVINAAKTGQNSEDKAFKKFVLCFFNKSAILNSDGTLNM 249 S C + VSTE+++ + G +ED+ K + +C + +N G +N+ Sbjct: 49 SACAPKFKVSTEMLDNLRGGIFAEDRELKCYTMCIAQMAGTMNKKGEINV 98 >AF437888-1|AAL84183.1| 154|Anopheles gambiae odorant binding protein protein. Length = 154 Score = 33.9 bits (74), Expect = 0.003 Identities = 14/50 (28%), Positives = 27/50 (54%) Frame = +1 Query: 100 SECVKESGVSTEVINAAKTGQNSEDKAFKKFVLCFFNKSAILNSDGTLNM 249 S C + VSTE+++ + G +ED+ K + +C + +N G +N+ Sbjct: 47 SACAPKFKVSTEMLDNLRGGIFAEDRELKCYTMCIAQMAGTMNKKGEINV 96 >AY146724-1|AAO12084.1| 151|Anopheles gambiae odorant-binding protein AgamOBP18 protein. Length = 151 Score = 33.1 bits (72), Expect = 0.006 Identities = 23/84 (27%), Positives = 33/84 (39%) Frame = +1 Query: 1 SVVLICLAFAVFNCGADNVHLTETQKEKAKQYTSECVKESGVSTEVINAAKTGQNSEDKA 180 +V + CL F A E AK C+ +S E+ N G +DK Sbjct: 14 AVGVYCLVFQPALVNAQQSLTQADMDEIAKGMRKVCMSRHKISEEMANYPSQGIFPDDKE 73 Query: 181 FKKFVLCFFNKSAILNSDGTLNMD 252 FK +V C + + + G LN D Sbjct: 74 FKCYVACLMDLTQ-TSKKGKLNYD 96 >AY146723-1|AAO12083.1| 155|Anopheles gambiae odorant-binding protein AgamOBP17 protein. Length = 155 Score = 32.3 bits (70), Expect = 0.010 Identities = 13/58 (22%), Positives = 32/58 (55%) Frame = +1 Query: 79 EKAKQYTSECVKESGVSTEVINAAKTGQNSEDKAFKKFVLCFFNKSAILNSDGTLNMD 252 E K C+ ++GV+ E I + ED+ K ++ C F+++ +++ +G ++++ Sbjct: 36 EALKPLHDICLGKTGVTEEAIKKFSDEEIHEDEKLKCYMNCLFHEAKVVDDNGDVHLE 93 >AY146721-1|AAO12081.1| 144|Anopheles gambiae odorant-binding protein AgamOBP1 protein. Length = 144 Score = 32.3 bits (70), Expect = 0.010 Identities = 13/58 (22%), Positives = 32/58 (55%) Frame = +1 Query: 79 EKAKQYTSECVKESGVSTEVINAAKTGQNSEDKAFKKFVLCFFNKSAILNSDGTLNMD 252 E K C+ ++GV+ E I + ED+ K ++ C F+++ +++ +G ++++ Sbjct: 36 EALKPLHDICLGKTGVTEEAIKKFSDEEIHEDEKLKCYMNCLFHEAKVVDDNGDVHLE 93 >AF437884-1|AAL84179.1| 144|Anopheles gambiae odorant binding protein protein. Length = 144 Score = 32.3 bits (70), Expect = 0.010 Identities = 13/58 (22%), Positives = 32/58 (55%) Frame = +1 Query: 79 EKAKQYTSECVKESGVSTEVINAAKTGQNSEDKAFKKFVLCFFNKSAILNSDGTLNMD 252 E K C+ ++GV+ E I + ED+ K ++ C F+++ +++ +G ++++ Sbjct: 36 EALKPLHDICLGKTGVTEEAIKKFSDEEIHEDEKLKCYMNCLFHEAKVVDDNGDVHLE 93 >AY146742-1|AAO12102.1| 154|Anopheles gambiae odorant-binding protein AgamOBP7 protein. Length = 154 Score = 31.5 bits (68), Expect = 0.017 Identities = 18/85 (21%), Positives = 40/85 (47%), Gaps = 1/85 (1%) Frame = +1 Query: 1 SVVLICLAFAVFNCGADNVHLTETQKEKAKQYTSECVKESGVSTEVINAAKTGQNSEDKA 180 ++V++ + ++ + + + K+ AK C+ ESG S E + G A Sbjct: 13 NLVVVLVLLTMYIVLSAPFEIPDRYKKPAKMLHEICIAESGASEEQLRTCLDGTVPTAPA 72 Query: 181 FKKFVLCFFNKSAILN-SDGTLNMD 252 K ++ C F+K +++ + G + +D Sbjct: 73 AKCYIHCLFDKIDVVDEATGRILLD 97 >AF437890-1|AAL84185.1| 154|Anopheles gambiae odorant binding protein protein. Length = 154 Score = 31.5 bits (68), Expect = 0.017 Identities = 18/85 (21%), Positives = 40/85 (47%), Gaps = 1/85 (1%) Frame = +1 Query: 1 SVVLICLAFAVFNCGADNVHLTETQKEKAKQYTSECVKESGVSTEVINAAKTGQNSEDKA 180 ++V++ + ++ + + + K+ AK C+ ESG S E + G A Sbjct: 13 NLVVVLVLLTMYIVLSAPFEIPDRYKKPAKMLHEICIAESGASEEQLRTCLDGTVPTAPA 72 Query: 181 FKKFVLCFFNKSAILN-SDGTLNMD 252 K ++ C F+K +++ + G + +D Sbjct: 73 AKCYIHCLFDKIDVVDEATGRILLD 97 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/40 (22%), Positives = 16/40 (40%) Frame = +2 Query: 284 KSEAQSVLEQCKDKTGQDAADKAFEIFQCYYKGTKTHILF 403 K+ + +C D + A+E +CY+ I F Sbjct: 108 KAAVDHLTRECSHIVTPDKCETAYETVKCYFNARDEVIKF 147 >AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding protein protein. Length = 155 Score = 31.5 bits (68), Expect = 0.017 Identities = 22/79 (27%), Positives = 30/79 (37%) Frame = +1 Query: 16 CLAFAVFNCGADNVHLTETQKEKAKQYTSECVKESGVSTEVINAAKTGQNSEDKAFKKFV 195 CL F A E AK C+ +S E+ N G +DK FK +V Sbjct: 23 CLVFRPALVHAQQSLTQADMDEIAKGMRKVCMSRPKISEEMANYPSQGIFPDDKEFKCYV 82 Query: 196 LCFFNKSAILNSDGTLNMD 252 C + + + G LN D Sbjct: 83 ACLMDLTQ-TSKKGKLNYD 100 >AY146722-1|AAO12082.1| 107|Anopheles gambiae odorant-binding protein AgamOBP16 protein. Length = 107 Score = 28.7 bits (61), Expect = 0.12 Identities = 13/54 (24%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 91 QYTSECVKESGVSTEVINAAKTGQNSE-DKAFKKFVLCFFNKSAILNSDGTLNM 249 Q+ SEC++E+G + E I + Q+ + + ++ C F + +G L++ Sbjct: 34 QFRSECLRETGTTDEQIEQFNSPQSVQASHELQCYMYCMFRLHNVTRPNGELDL 87 >AY146720-1|AAO12080.1| 147|Anopheles gambiae odorant-binding protein AgamOBP15 protein. Length = 147 Score = 28.7 bits (61), Expect = 0.12 Identities = 13/54 (24%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 91 QYTSECVKESGVSTEVINAAKTGQNSE-DKAFKKFVLCFFNKSAILNSDGTLNM 249 Q+ SEC++E+G + E I + Q+ + + ++ C F + +G L++ Sbjct: 34 QFRSECLRETGTTDEQIEQFNSPQSVQASHELQCYMYCMFRLHNVTRPNGELDL 87 >AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-binding protein OBPjj10 protein. Length = 207 Score = 27.1 bits (57), Expect = 0.38 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 190 FVLCFFNKSAILNSDGTLNMDV 255 FV CF +K+ ++ DG + DV Sbjct: 123 FVKCFLDKAGFIDDDGVIQQDV 144 >AY146737-1|AAO12097.1| 119|Anopheles gambiae odorant-binding protein AgamOBP27 protein. Length = 119 Score = 25.4 bits (53), Expect = 1.1 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = +2 Query: 278 VNKSEAQSVLEQCKDKTGQDAADKAFEIFQCYYK 379 V+K ++ V C D AF+++QC Y+ Sbjct: 76 VSKEISEKVYNICTDNVTPTYCVTAFDVYQCIYE 109 >AJ697722-1|CAG26915.1| 119|Anopheles gambiae putative odorant-binding protein OBPjj12 protein. Length = 119 Score = 25.4 bits (53), Expect = 1.1 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = +2 Query: 278 VNKSEAQSVLEQCKDKTGQDAADKAFEIFQCYYK 379 V+K ++ V C D AF+++QC Y+ Sbjct: 76 VSKEISEKVYNICTDNVTPTYCVTAFDVYQCIYE 109 >AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding protein AgamOBP30 protein. Length = 289 Score = 24.6 bits (51), Expect = 2.0 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = +2 Query: 335 DAADKAFEIFQCYYK 379 +A ++A+E F+CYY+ Sbjct: 142 EACERAYESFRCYYE 156 >AY146755-1|AAO12070.1| 320|Anopheles gambiae odorant-binding protein AgamOBP32 protein. Length = 320 Score = 24.6 bits (51), Expect = 2.0 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = +2 Query: 335 DAADKAFEIFQCYYK 379 D ++A+E F+CYY+ Sbjct: 126 DVCERAYESFRCYYE 140 >AY146754-1|AAO12069.1| 334|Anopheles gambiae odorant-binding protein AgamOBP33 protein. Length = 334 Score = 24.6 bits (51), Expect = 2.0 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = +2 Query: 335 DAADKAFEIFQCYYK 379 D ++A+E F+CYY+ Sbjct: 126 DVCERAYESFRCYYE 140 >AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding protein OBPjj83c protein. Length = 273 Score = 24.6 bits (51), Expect = 2.0 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = +2 Query: 335 DAADKAFEIFQCYYK 379 +A ++A+E F+CYY+ Sbjct: 126 EACERAYESFRCYYE 140 >AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding protein 1 protein. Length = 289 Score = 24.6 bits (51), Expect = 2.0 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = +2 Query: 335 DAADKAFEIFQCYYK 379 +A ++A+E F+CYY+ Sbjct: 142 EACERAYESFRCYYE 156 >AY146747-1|AAO12062.1| 288|Anopheles gambiae odorant-binding protein AgamOBP42 protein. Length = 288 Score = 23.8 bits (49), Expect = 3.5 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 317 KDKTGQDAADKAFEIFQCY 373 K D +AFE FQCY Sbjct: 114 KAPVDDDLCSRAFETFQCY 132 >AJ618931-1|CAF02009.1| 288|Anopheles gambiae odorant-binding protein OBPjj83d protein. Length = 288 Score = 23.8 bits (49), Expect = 3.5 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 317 KDKTGQDAADKAFEIFQCY 373 K D +AFE FQCY Sbjct: 114 KAPVDDDLCSRAFETFQCY 132 >AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltransferase protein. Length = 426 Score = 23.0 bits (47), Expect = 6.1 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -3 Query: 292 FRFINTRRKFSSAHPCSVYHL 230 F + +KF S+HP S +H+ Sbjct: 295 FNLFDNFKKFRSSHPQSNFHI 315 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.0 bits (47), Expect = 6.1 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -2 Query: 185 LKALSSEFCPVFAAFITSVL 126 LKALS EFC + A F ++VL Sbjct: 119 LKALSLEFCKI-AKFSSTVL 137 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 488,550 Number of Sequences: 2352 Number of extensions: 9820 Number of successful extensions: 60 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -