BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30697 (387 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 23 3.9 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 23 3.9 AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 23 5.1 AY146734-1|AAO12094.1| 176|Anopheles gambiae odorant-binding pr... 22 9.0 AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-b... 22 9.0 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 23.0 bits (47), Expect = 3.9 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 42 RKCVRVQLIKNGKKVT 89 RKCVR L K+G ++T Sbjct: 330 RKCVRSTLAKHGNEMT 345 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.0 bits (47), Expect = 3.9 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -3 Query: 253 FLFVESEERHV--GYFYHLKTNSGNVTDGVTF 164 F + +++ +V G+F+HL+ N G + TF Sbjct: 906 FSQIAADDHYVPSGFFFHLRKNMGGLKRFSTF 937 >AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin GPCR protein. Length = 634 Score = 22.6 bits (46), Expect = 5.1 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -2 Query: 311 ALPDSRSLITMYTYDLGRSFSLCRERGETRW 219 A+ S ++ T+ L R F++CR RW Sbjct: 189 AVSVSVAVWTLVAISLERYFAICRPLSSRRW 219 >AY146734-1|AAO12094.1| 176|Anopheles gambiae odorant-binding protein AgamOBP24 protein. Length = 176 Score = 21.8 bits (44), Expect = 9.0 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 6 VGVEAKQPNSAIRKC 50 VG+EA + N I+KC Sbjct: 120 VGIEAGKVNELIKKC 134 >AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-binding protein OBPjj10 protein. Length = 207 Score = 21.8 bits (44), Expect = 9.0 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 6 VGVEAKQPNSAIRKC 50 VG+EA + N I+KC Sbjct: 151 VGIEAGKVNELIKKC 165 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 388,633 Number of Sequences: 2352 Number of extensions: 7069 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 29929410 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -