BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30695 (662 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93221-1|AAA60389.1| 1456|Homo sapiens mannose receptor protein. 33 0.91 J05550-1|AAA59868.1| 1456|Homo sapiens M6PR protein. 33 0.91 DQ663787-1|ABG47462.1| 1456|Homo sapiens mannose receptor protein. 33 0.91 BX255924-1|CAI15339.1| 1456|Homo sapiens mannose receptor, C typ... 33 0.91 AL928729-2|CAH70733.1| 1456|Homo sapiens mannose receptor, C typ... 33 0.91 AL928580-1|CAH71176.1| 1456|Homo sapiens mannose receptor, C typ... 33 0.91 AL139238-2|CAH70872.1| 1456|Homo sapiens mannose receptor, C typ... 33 0.91 U17033-1|AAA70110.1| 1465|Homo sapiens 180 kDa transmembrane PLA... 31 2.8 AC093873-2|AAY24190.1| 495|Homo sapiens unknown protein. 31 2.8 EF175434-1|ABM53266.1| 103|Homo sapiens immunoglobulin heavy ch... 30 6.4 DQ100921-1|AAZ08927.1| 128|Homo sapiens immunoglobulin heavy ch... 30 6.4 >M93221-1|AAA60389.1| 1456|Homo sapiens mannose receptor protein. Length = 1456 Score = 33.1 bits (72), Expect = 0.91 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 551 NGCIALKAPSFHWEPQHCGEIKDFICEQTR 640 N C+AL A S W HC K +IC++ + Sbjct: 1330 NDCVALHASSGFWSNIHCSSYKGYICKRPK 1359 >J05550-1|AAA59868.1| 1456|Homo sapiens M6PR protein. Length = 1456 Score = 33.1 bits (72), Expect = 0.91 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 551 NGCIALKAPSFHWEPQHCGEIKDFICEQTR 640 N C+AL A S W HC K +IC++ + Sbjct: 1330 NDCVALHASSGFWSNIHCSSYKGYICKRPK 1359 >DQ663787-1|ABG47462.1| 1456|Homo sapiens mannose receptor protein. Length = 1456 Score = 33.1 bits (72), Expect = 0.91 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 551 NGCIALKAPSFHWEPQHCGEIKDFICEQTR 640 N C+AL A S W HC K +IC++ + Sbjct: 1330 NDCVALHASSGFWSNIHCSSYKGYICKRPK 1359 >BX255924-1|CAI15339.1| 1456|Homo sapiens mannose receptor, C type 1-like 1 protein. Length = 1456 Score = 33.1 bits (72), Expect = 0.91 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 551 NGCIALKAPSFHWEPQHCGEIKDFICEQTR 640 N C+AL A S W HC K +IC++ + Sbjct: 1330 NDCVALHASSGFWSNIHCSSYKGYICKRPK 1359 >AL928729-2|CAH70733.1| 1456|Homo sapiens mannose receptor, C type 1 protein. Length = 1456 Score = 33.1 bits (72), Expect = 0.91 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 551 NGCIALKAPSFHWEPQHCGEIKDFICEQTR 640 N C+AL A S W HC K +IC++ + Sbjct: 1330 NDCVALHASSGFWSNIHCSSYKGYICKRPK 1359 >AL928580-1|CAH71176.1| 1456|Homo sapiens mannose receptor, C type 1-like 1 protein. Length = 1456 Score = 33.1 bits (72), Expect = 0.91 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 551 NGCIALKAPSFHWEPQHCGEIKDFICEQTR 640 N C+AL A S W HC K +IC++ + Sbjct: 1330 NDCVALHASSGFWSNIHCSSYKGYICKRPK 1359 >AL139238-2|CAH70872.1| 1456|Homo sapiens mannose receptor, C type 1-like 1 protein. Length = 1456 Score = 33.1 bits (72), Expect = 0.91 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 551 NGCIALKAPSFHWEPQHCGEIKDFICEQTR 640 N C+AL A S W HC K +IC++ + Sbjct: 1330 NDCVALHASSGFWSNIHCSSYKGYICKRPK 1359 >U17033-1|AAA70110.1| 1465|Homo sapiens 180 kDa transmembrane PLA2 receptor precursor protein. Length = 1465 Score = 31.5 bits (68), Expect = 2.8 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 533 TEHVMTNGCIALKAPSFHWEPQHCGEIKDFICE 631 T++ + C+AL+ P W+ C E K FIC+ Sbjct: 1348 TDYFKPHHCVALRIPEGLWQLSPCQEKKGFICK 1380 >AC093873-2|AAY24190.1| 495|Homo sapiens unknown protein. Length = 495 Score = 31.5 bits (68), Expect = 2.8 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 533 TEHVMTNGCIALKAPSFHWEPQHCGEIKDFICE 631 T++ + C+AL+ P W+ C E K FIC+ Sbjct: 378 TDYFKPHHCVALRIPEGLWQLSPCQEKKGFICK 410 >EF175434-1|ABM53266.1| 103|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 103 Score = 30.3 bits (65), Expect = 6.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 599 HCGEIKDFICEQTRCYYYYYG 661 +C + C T CYYYYYG Sbjct: 74 YCARHRLGYCSSTSCYYYYYG 94 >DQ100921-1|AAZ08927.1| 128|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 128 Score = 30.3 bits (65), Expect = 6.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 599 HCGEIKDFICEQTRCYYYYYG 661 +C + C T CYYYYYG Sbjct: 94 YCARHRLGYCSSTSCYYYYYG 114 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,015,867 Number of Sequences: 237096 Number of extensions: 2335679 Number of successful extensions: 10322 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 9890 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10320 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7478817430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -