BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30695 (662 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g00340.1 68417.m00045 S-locus glycoprotein family protein / c... 27 8.4 At3g18060.1 68416.m02297 transducin family protein / WD-40 repea... 27 8.4 >At4g00340.1 68417.m00045 S-locus glycoprotein family protein / curculin-like (mannose-binding) lectin family protein / PAN domain-containing protein contains Pfam profiles: PF01453 lectin (probable mannose binding), PF00954 S-locus glycoprotein family, PF00024 PAN domain Length = 402 Score = 27.5 bits (58), Expect = 8.4 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 4/46 (8%) Frame = -3 Query: 396 RCSSTKTCL----CRGYYPMSRSHICCNLHLLDKSLSNLPSPSSRT 271 + S KTCL C G+Y +S++C +L +S +NL + SS T Sbjct: 356 KSSCAKTCLGNSSCVGFYHKEKSNLC---KILLESPNNLKNSSSET 398 >At3g18060.1 68416.m02297 transducin family protein / WD-40 repeat family protein similar to 66 kDa stress protein (SP:P90587) [Physarum polycephalum (Slime mold)]; similar to WDR1 protein GB:AAD05042 [Gallus gallus] (Genomics 56 (1), 59-69 (1999)); contains 11 WD-40 repeats (PF00400) Length = 609 Score = 27.5 bits (58), Expect = 8.4 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 621 KSLISPQC*GSQWKLGALSAMQPLVMTCSV----PCRAVRCGQCFLVVRLEGP 475 KSL+ S +G V++C++ P R V CG+ FLV EGP Sbjct: 123 KSLVRAFMWDSGSNVGEFDGHSRRVLSCAIKPTRPFRIVTCGEDFLVNFYEGP 175 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,686,072 Number of Sequences: 28952 Number of extensions: 317211 Number of successful extensions: 779 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 779 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1393347168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -