BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30693 (633 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) 113 1e-25 SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) 30 1.4 SB_50950| Best HMM Match : AAA_5 (HMM E-Value=0.0006) 28 5.5 SB_9051| Best HMM Match : Y_phosphatase (HMM E-Value=0) 28 5.5 SB_57953| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_31354| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_19612| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 >SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) Length = 157 Score = 113 bits (272), Expect = 1e-25 Identities = 54/81 (66%), Positives = 68/81 (83%) Frame = +1 Query: 10 STKIIKATGAEADSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVP 189 S KI+K G A+ FE ISQA++ELE NSD+KAQLRELYI+ AKEI++ KK+III+VP Sbjct: 8 SAKIVKPQGETANEFEQGISQAILELEMNSDMKAQLRELYISSAKEIDVGGKKAIIIFVP 67 Query: 190 MPKLKAFQKIQIRLVRELEKK 252 +P+++AFQKIQ RLVRELEKK Sbjct: 68 VPQIRAFQKIQTRLVRELEKK 88 Score = 46.8 bits (106), Expect(2) = 2e-10 Identities = 22/35 (62%), Positives = 27/35 (77%) Frame = +3 Query: 246 KEVSGKHVVFVGDRKILPKPSHKTRVANKQKRPRS 350 K+ SGKHVV V R+ILP+P+ K+R KQKRPRS Sbjct: 87 KKFSGKHVVIVAQRRILPRPTRKSR-NQKQKRPRS 120 Score = 35.9 bits (79), Expect(2) = 2e-10 Identities = 15/26 (57%), Positives = 22/26 (84%), Gaps = 1/26 (3%) Frame = +3 Query: 462 HLDKNQQTTIEHKVDT-SSLYQEANG 536 HLDK QQTTI+HK++T S++Y++ G Sbjct: 121 HLDKTQQTTIDHKLETFSTVYKKLTG 146 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +1 Query: 472 KTNRLLLNIKW-TLPVCIKKLTGREVTFEFP 561 KT + ++ K T KKLTG++V FEFP Sbjct: 124 KTQQTTIDHKLETFSTVYKKLTGKDVVFEFP 154 >SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) Length = 3107 Score = 30.3 bits (65), Expect = 1.4 Identities = 29/91 (31%), Positives = 50/91 (54%), Gaps = 6/91 (6%) Frame = +1 Query: 1 VKMSTKI--IKATGAEADSFETSISQALVELETNSDLKAQLRE----LYITKAKEIELHN 162 V+MS ++ ++++G +S E+ + E N+ LK +L E L +T+ +E E+ N Sbjct: 1673 VRMSERVSVLESSGGTMNSEESFFLE-----EDNAILKRKLDEKETALKVTQDREREM-N 1726 Query: 163 KKSIIIYVPMPKLKAFQKIQIRLVRELEKKL 255 K + +YV M KL++ Q ELEK+L Sbjct: 1727 DKLMALYVNMSKLESTQGTLEEKNAELEKEL 1757 >SB_50950| Best HMM Match : AAA_5 (HMM E-Value=0.0006) Length = 1552 Score = 28.3 bits (60), Expect = 5.5 Identities = 15/57 (26%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +1 Query: 46 DSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVPM-PKLKAFQ 213 + ++T ++ L + L+ +RELY +E E KKS++ ++ + PK+K + Sbjct: 171 EQWDTILTMIPARLVQSPQLQPYIRELYAEVKQEYEASIKKSMVQHILVKPKVKGVE 227 >SB_9051| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 1831 Score = 28.3 bits (60), Expect = 5.5 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 98 PTSKPNFGSFTLQKLKKLNYTIRS 169 P S N+G FT+++LK +YT +S Sbjct: 1415 PLSNDNYGDFTMRRLKVSSYTEQS 1438 >SB_57953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 712 Score = 27.9 bits (59), Expect = 7.2 Identities = 16/59 (27%), Positives = 31/59 (52%) Frame = +3 Query: 246 KEVSGKHVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSVYDAILEDLVFPAEIVGKR 422 ++VS + + DR+ + K + R+ + + TL V DA+ E+L P +++G R Sbjct: 507 RQVSVEDRPMMSDRRSMSKHGVQWRILSIYYTDTTVTLEEVKDAVKEELDGPGKLLGYR 565 >SB_31354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2286 Score = 27.9 bits (59), Expect = 7.2 Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +3 Query: 417 KRIRVKLDGSQLIKVHLDKNQQTTIEHKVDTSSLYQEA---NGTRSDL 551 KR R++ + I V LDK T H SSL EA G +SDL Sbjct: 40 KRARLRAHPTIPITVSLDKQTTTRHSHSARNSSLQAEAIADTGAQSDL 87 >SB_19612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 932 Score = 27.5 bits (58), Expect = 9.6 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -3 Query: 487 VVCWFLSKCTLMSCEPSNLTLMRLPTISAGKTKSSR 380 V+CW L + + + EP N L +L ++ GK K S+ Sbjct: 339 VICWVLGEYSYIVSEP-NTVLEQLHSLLDGKLKDSK 373 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,910,514 Number of Sequences: 59808 Number of extensions: 327666 Number of successful extensions: 815 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 747 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 810 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1584657875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -