BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30693 (633 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z75714-1|CAB00058.1| 194|Caenorhabditis elegans Hypothetical pr... 114 4e-26 U23179-7|AAC46721.1| 782|Caenorhabditis elegans Hypothetical pr... 29 3.7 >Z75714-1|CAB00058.1| 194|Caenorhabditis elegans Hypothetical protein ZC434.2 protein. Length = 194 Score = 114 bits (275), Expect = 4e-26 Identities = 53/109 (48%), Positives = 78/109 (71%), Gaps = 2/109 (1%) Frame = +3 Query: 246 KEVSGKHVVFVGDRKILPKPSHKTRVA-NKQKRPRSRTLTSVYDAILEDLVFPAEIVGKR 422 K+ G+ ++ + R+ILPKP ++ KQKRPRSRTLT+V+DA L++LV+PAE+VG+R Sbjct: 84 KKFGGRDILILAKRRILPKPQRGSKARPQKQKRPRSRTLTAVHDAWLDELVYPAEVVGRR 143 Query: 423 IRVKLDGSQLIKVHLDKNQQTTIEHKVDT-SSLYQEANGTRSDLRVPEP 566 IRVKLDG ++ KVHLDK+ QT + HK+ +S+Y++ G P+P Sbjct: 144 IRVKLDGKKVYKVHLDKSHQTNVGHKIGVFASVYRKLTGKDVTFEFPDP 192 Score = 99.1 bits (236), Expect = 2e-21 Identities = 46/79 (58%), Positives = 60/79 (75%) Frame = +1 Query: 16 KIIKATGAEADSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVPMP 195 K++K+ G E +SQAL++LETN D+++QL+ELYI KE+EL NK +IIIYVP+P Sbjct: 7 KLLKSDGKVVSEIEKQVSQALIDLETNDDVQSQLKELYIVGVKEVELGNKSAIIIYVPVP 66 Query: 196 KLKAFQKIQIRLVRELEKK 252 +LKAF KI LVRELEKK Sbjct: 67 QLKAFHKIHPALVRELEKK 85 Score = 28.7 bits (61), Expect = 3.7 Identities = 11/16 (68%), Positives = 15/16 (93%) Frame = +1 Query: 523 KKLTGREVTFEFPNLI 570 +KLTG++VTFEFP+ I Sbjct: 178 RKLTGKDVTFEFPDPI 193 >U23179-7|AAC46721.1| 782|Caenorhabditis elegans Hypothetical protein C27D6.1 protein. Length = 782 Score = 28.7 bits (61), Expect = 3.7 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 3/61 (4%) Frame = +1 Query: 1 VKMSTKIIKATGAEADSFE---TSISQALVELETNSDLKAQLRELYITKAKEIELHNKKS 171 +K + K K AEA+ ++ T S+ L ELE Q +E + K++E+E+ NK+ Sbjct: 242 LKANEKARKEIEAEAEKWKDRATRNSKRLPELELELAETVQAKEEWQVKSQEMEIQNKQL 301 Query: 172 I 174 + Sbjct: 302 V 302 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,574,977 Number of Sequences: 27780 Number of extensions: 244839 Number of successful extensions: 661 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 647 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 660 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1395683256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -