BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30692 (666 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0389 - 2915191-2915604,2915696-2915752,2915867-2915922,291... 29 3.3 03_05_1065 + 30061588-30061883,30061995-30062056,30062196-300622... 29 3.3 03_05_0725 + 27155736-27155746,27155798-27155949,27156108-271580... 29 4.4 06_03_1397 - 29861108-29861206,29861683-29861748,29862066-298621... 28 7.7 >07_01_0389 - 2915191-2915604,2915696-2915752,2915867-2915922, 2916053-2916113,2916243-2916365,2916505-2916537, 2916617-2916709,2916839-2916934,2917025-2917203, 2917344-2917530,2918051-2918184,2918311-2918518, 2918598-2918633,2918785-2919241,2919633-2919736, 2920489-2920569,2920646-2920697,2920837-2920876, 2920991-2921085,2921241-2921383,2921899-2922006, 2922120-2922221,2922302-2922348,2922425-2922554, 2923173-2923304,2923404-2923616,2923709-2923963, 2924053-2924799 Length = 1460 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/32 (50%), Positives = 20/32 (62%), Gaps = 3/32 (9%) Frame = -2 Query: 656 WVGTHVVEF--LIKLNVDVGRLSELY-SDGIE 570 WVG HV EF + ++D G LS+ Y DGIE Sbjct: 626 WVGEHVAEFDTVFLADLDDGELSKKYVCDGIE 657 >03_05_1065 + 30061588-30061883,30061995-30062056,30062196-30062276, 30062391-30062464,30062547-30062629,30063044-30063147, 30063526-30063665,30063736-30063783,30063939-30063991, 30064178-30064262,30064346-30064412,30064496-30064606, 30065262-30065283,30066244-30071110,30071186-30071374, 30071463-30071577,30072329-30073388,30074247-30074694, 30074966-30075019,30075105-30076898,30076989-30077949, 30078271-30078384,30078459-30078613,30078934-30079026, 30079341-30079613,30093423-30093975,30094465-30094540, 30094619-30094718 Length = 4025 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/29 (37%), Positives = 23/29 (79%) Frame = -2 Query: 386 HDVLVNEKLKRDLLAFLVVKYEGAILEHD 300 H + ++++++++L L +KYEGA+L+HD Sbjct: 1661 HPLSSSDEMEKEMLT-LNIKYEGALLKHD 1688 >03_05_0725 + 27155736-27155746,27155798-27155949,27156108-27158068, 27159169-27159397,27159506-27159634,27159725-27159838, 27160059-27160258,27160301-27160599,27160713-27160923, 27161017-27161172,27161290-27161447,27161532-27161724, 27162015-27162406,27162537-27162717,27162802-27163031, 27163108-27163753,27163833-27163902,27163994-27164244 Length = 1860 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = +2 Query: 65 LLVTDPLHSFLNNSTCCSTYSSKLF--NGQEERTLYFGFP 178 LLV +PL +FL+ C S+++ NG +E L FP Sbjct: 978 LLVNNPLDNFLDGPDSCEKILSEIYETNGSKEAVLNVLFP 1017 >06_03_1397 - 29861108-29861206,29861683-29861748,29862066-29862155, 29862604-29862652,29862820-29862950,29863989-29864087, 29864169-29864204,29864467-29864557,29864814-29864994, 29865063-29865150,29865222-29865335 Length = 347 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = -1 Query: 234 QFPEKSPILTLRSVYH-SSKGKPKYKVLSSCPLNNF 130 QFP+ P+LTL S H +++G P + S P+N++ Sbjct: 301 QFPKHQPVLTLESSQHFNAQGLP----IMSAPVNDY 332 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,015,408 Number of Sequences: 37544 Number of extensions: 324108 Number of successful extensions: 667 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 649 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 667 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1679486824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -