BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30681 (710 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50629| Best HMM Match : Extensin_2 (HMM E-Value=0.94) 35 0.057 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 33 0.30 SB_16955| Best HMM Match : SLAP (HMM E-Value=0.048) 33 0.30 SB_8696| Best HMM Match : Pox_A32 (HMM E-Value=0.16) 32 0.40 SB_47942| Best HMM Match : TSP_1 (HMM E-Value=0) 31 0.92 SB_35934| Best HMM Match : HC2 (HMM E-Value=4.4) 31 0.92 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_50256| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_31131| Best HMM Match : Drf_FH1 (HMM E-Value=2.4) 31 0.92 SB_151| Best HMM Match : zf-CCHC (HMM E-Value=8.9e-05) 31 0.92 SB_28630| Best HMM Match : DUF1665 (HMM E-Value=3.4) 30 1.6 SB_9683| Best HMM Match : RCSD (HMM E-Value=2.8) 30 1.6 SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_38269| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_34601| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_39858| Best HMM Match : Spectrin (HMM E-Value=2.6e-05) 30 2.1 SB_20713| Best HMM Match : Pkinase (HMM E-Value=0) 30 2.1 SB_18653| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_12669| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_51476| Best HMM Match : Ion_trans (HMM E-Value=6.29996e-41) 29 3.7 SB_46439| Best HMM Match : RVT_1 (HMM E-Value=4.8e-25) 29 3.7 SB_21143| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.42) 29 3.7 SB_50370| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_7782| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_56888| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_43849| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_37844| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_31972| Best HMM Match : RVT_1 (HMM E-Value=2.4e-14) 28 6.5 SB_17670| Best HMM Match : RVT_1 (HMM E-Value=6.1e-25) 28 6.5 SB_47161| Best HMM Match : rve (HMM E-Value=1.8e-22) 28 6.5 SB_34910| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_17276| Best HMM Match : E-MAP-115 (HMM E-Value=0.57) 28 6.5 SB_8541| Best HMM Match : Vicilin_N (HMM E-Value=1.7) 28 6.5 SB_4115| Best HMM Match : Homeobox (HMM E-Value=9.4e-08) 28 6.5 SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) 28 8.6 SB_25899| Best HMM Match : Ribonuc_2-5A (HMM E-Value=0) 28 8.6 SB_31408| Best HMM Match : ENTH (HMM E-Value=0) 28 8.6 SB_24848| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_6746| Best HMM Match : rve (HMM E-Value=2.4) 28 8.6 >SB_50629| Best HMM Match : Extensin_2 (HMM E-Value=0.94) Length = 450 Score = 35.1 bits (77), Expect = 0.057 Identities = 33/111 (29%), Positives = 49/111 (44%), Gaps = 4/111 (3%) Frame = +2 Query: 287 QRISDIETSRNKQFS----ANLRHRSSRQKQFPVNLRQRTISKTETVTSSSPIVQLSENH 454 Q+ I+T R Q A R RS ++ PV+ RQR+ S S Q S + Sbjct: 242 QQYQPIQTRRRSQSPGQTYATKRGRSHSPRRVPVSPRQRSNSPRRVPVSPR---QRSNS- 297 Query: 455 Q*TRQLPVKPRYRSRNPSKKQPSSTSAQTDSKKHYYTTRKQPYRPGRVQYS 607 R++PV PR RS +P + S ++ ++R+Q P RV S Sbjct: 298 --PRRVPVSPRQRSNSPRRVPVSPRQRPNLPRRVPLSSRQQSNSPRRVPLS 346 Score = 33.9 bits (74), Expect = 0.13 Identities = 26/83 (31%), Positives = 42/83 (50%) Frame = +2 Query: 341 RHRSSRQKQFPVNLRQRTISKTETVTSSSPIVQLSENHQ*TRQLPVKPRYRSRNPSKKQP 520 R RS+ ++ PV+ RQR+ S S Q S + R++PV PR R P ++ P Sbjct: 278 RQRSNSPRRVPVSPRQRSNSPRRVPVSPR---QRSNS---PRRVPVSPRQRPNLP-RRVP 330 Query: 521 SSTSAQTDSKKHYYTTRKQPYRP 589 S+ Q++S + + +Q RP Sbjct: 331 LSSRQQSNSPRRVPLSPRQQSRP 353 >SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) Length = 460 Score = 32.7 bits (71), Expect = 0.30 Identities = 37/131 (28%), Positives = 56/131 (42%) Frame = +1 Query: 181 TYRSRDPRKWRVDSASRDGVLK*I*RMAIYRQKQFSANLRHRNIKKQTVLSESPTQIIKT 360 T R +D RK RV + G R I+ + Q + TVL E+ IIKT Sbjct: 57 TERRKDDRKLRVVVSGSCGS-----RRRIHGKHQVFTTSTQNPSGRPTVLLENSEPIIKT 111 Query: 361 ETVPSESSTKNHQQDRNSYQQFSNSTVIRKPPVNQTVTCETSLQKPKPIEETAVFYQRTN 540 ++ + + H++D S N P TVT E S +PI+ + RT+ Sbjct: 112 QS--HFMAFRTHRKDPQSLHSTQN------PSGRTTVTLEHS----EPIDTQSFRALRTH 159 Query: 541 RQQKTLLHDSE 573 R++ LH S+ Sbjct: 160 REEPQSLHSSQ 170 >SB_16955| Best HMM Match : SLAP (HMM E-Value=0.048) Length = 1952 Score = 32.7 bits (71), Expect = 0.30 Identities = 23/59 (38%), Positives = 33/59 (55%), Gaps = 5/59 (8%) Frame = +2 Query: 383 RQRTISKT-ETVTSS--SPIVQLSENHQ*TRQLPVKPR--YRSRNPSKKQPSSTSAQTD 544 R+R S T E V S SP V S + R+ P KP+ YR + P +++PSS+S +D Sbjct: 1224 RKRVRSFTPEQVKSDAPSPPVNASRDLPYYREYPTKPKDLYRGKKPRRQRPSSSSESSD 1282 >SB_8696| Best HMM Match : Pox_A32 (HMM E-Value=0.16) Length = 1152 Score = 32.3 bits (70), Expect = 0.40 Identities = 28/76 (36%), Positives = 36/76 (47%), Gaps = 6/76 (7%) Frame = +1 Query: 142 TNRNDLWSAFT---TVTYRSRDPRKWRVDSASRDGVLK*I*RMAIYRQKQF---SANLRH 303 T R +L +AFT V R+ + R+WR S SR I + RQ+ SANL Sbjct: 865 TRRRELAAAFTRTPAVNQRATEHRRWRPHSRSR------IDHLPFRRQRYALPDSANLDC 918 Query: 304 RNIKKQTVLSESPTQI 351 + KQT E PT I Sbjct: 919 KQWSKQTFRHEGPTHI 934 >SB_47942| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 2195 Score = 31.1 bits (67), Expect = 0.92 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 5/61 (8%) Frame = +2 Query: 485 RYRSRNPSKKQP-----SSTSAQTDSKKHYYTTRKQPYRPGRVQYSIFKECCISCGYVTI 649 RYR RN S+ P + + D ++ T P G +++ F EC +SCG T Sbjct: 288 RYRYRNCSQPLPQHGGRNCSHLGDDKEQENCNTHMCPIHGGYTEWTNFTECTVSCGNGTK 347 Query: 650 F 652 F Sbjct: 348 F 348 >SB_35934| Best HMM Match : HC2 (HMM E-Value=4.4) Length = 181 Score = 31.1 bits (67), Expect = 0.92 Identities = 18/59 (30%), Positives = 27/59 (45%) Frame = +1 Query: 355 KTETVPSESSTKNHQQDRNSYQQFSNSTVIRKPPVNQTVTCETSLQKPKPIEETAVFYQ 531 KTE + + S T+ Q Y Q T ++PPV T + K P++ T V+ Q Sbjct: 21 KTEALLASSITRPLLQYTTVYSQ----TCTKRPPVQHTTVSSQTCTKRSPVQHTTVYSQ 75 Score = 28.3 bits (60), Expect = 6.5 Identities = 21/89 (23%), Positives = 37/89 (41%) Frame = +1 Query: 295 LRHRNIKKQTVLSESPTQIIKTETVPSESSTKNHQQDRNSYQQFSNSTVIRKPPVNQTVT 474 ++H + QT + P Q TV S + K Y + T ++PPV T+ Sbjct: 67 VQHTTVYSQTCIKRLPVQYT---TVYSLTCIKRLPVQ---YTTVYSQTCTKRPPVQYTMV 120 Query: 475 CETSLQKPKPIEETAVFYQRTNRQQKTLL 561 + K P++ T V Q + + T++ Sbjct: 121 YSQTCTKRPPVQYTMVNIQSSTYKMTTVM 149 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 31.1 bits (67), Expect = 0.92 Identities = 23/101 (22%), Positives = 46/101 (45%), Gaps = 6/101 (5%) Frame = +1 Query: 316 KQTVLSESPTQIIKTETVPSESSTKNHQQDRNSYQQ--FSNSTVIRKPPVNQTVTCETSL 489 K+TV+ +PT+ + T+ +P+E + ++ Q + STV ++ VT +T + Sbjct: 281 KRTVIKPTPTESVVTKPIPAEGAVTKQTSTESAVTQPEPTESTVTKQITTESVVTKQTPI 340 Query: 490 QK----PKPIEETAVFYQRTNRQQKTLLHDSETAIQTGSCT 600 + P P E+ V T+ +E+ + T + T Sbjct: 341 ESAVTMPAP-TESVVTMPAPTESVVTMPAPTESVVTTATPT 380 >SB_50256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 31.1 bits (67), Expect = 0.92 Identities = 18/59 (30%), Positives = 27/59 (45%) Frame = +1 Query: 355 KTETVPSESSTKNHQQDRNSYQQFSNSTVIRKPPVNQTVTCETSLQKPKPIEETAVFYQ 531 KTE + + S T+ Q Y Q T ++PPV T + K P++ T V+ Q Sbjct: 21 KTEALLASSITRPLLQYTTVYSQ----TCTKRPPVQHTTVSSQTCTKRSPVQHTTVYSQ 75 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/65 (24%), Positives = 30/65 (46%) Frame = +1 Query: 352 IKTETVPSESSTKNHQQDRNSYQQFSNSTVIRKPPVNQTVTCETSLQKPKPIEETAVFYQ 531 ++ TV S++ TK Y + T ++PPV T + K P++ T V++Q Sbjct: 99 VQYTTVYSQTCTKRPPVQ---YTTVYSQTCTKRPPVQHTTVYSHTCTKRTPVQYTMVYWQ 155 Query: 532 RTNRQ 546 ++ Sbjct: 156 TCTKR 160 >SB_31131| Best HMM Match : Drf_FH1 (HMM E-Value=2.4) Length = 407 Score = 31.1 bits (67), Expect = 0.92 Identities = 23/101 (22%), Positives = 46/101 (45%), Gaps = 6/101 (5%) Frame = +1 Query: 316 KQTVLSESPTQIIKTETVPSESSTKNHQQDRNSYQQ--FSNSTVIRKPPVNQTVTCETSL 489 K+TV+ +PT+ + T+ +P+E + ++ Q + STV ++ VT +T + Sbjct: 33 KRTVIKPTPTESVVTKPIPAEGAVTKQTSTESAVTQPEPTESTVTKQITTESVVTKQTPI 92 Query: 490 QK----PKPIEETAVFYQRTNRQQKTLLHDSETAIQTGSCT 600 + P P E+ V T+ +E+ + T + T Sbjct: 93 ESAVTMPAP-TESVVTMPAPTESVVTMPAPTESVVTTATPT 132 >SB_151| Best HMM Match : zf-CCHC (HMM E-Value=8.9e-05) Length = 1382 Score = 31.1 bits (67), Expect = 0.92 Identities = 27/91 (29%), Positives = 40/91 (43%) Frame = +1 Query: 361 ETVPSESSTKNHQQDRNSYQQFSNSTVIRKPPVNQTVTCETSLQKPKPIEETAVFYQRTN 540 + +P++ S + QQD NS Q +T PP+ Q E + + P+ T VFYQ + Sbjct: 847 KAMPNDPSLEIDQQDSNS-QNHPRATP-PTPPITQQ---EITHSQQSPVTTTNVFYQWID 901 Query: 541 RQQKTLLHDSETAIQTGSCTIFYFQRVLYFL 633 L+ ET +Q T LY L Sbjct: 902 ----NLVEFEETIVQPQESTTMSIAEALYKL 928 >SB_28630| Best HMM Match : DUF1665 (HMM E-Value=3.4) Length = 428 Score = 30.3 bits (65), Expect = 1.6 Identities = 26/109 (23%), Positives = 55/109 (50%), Gaps = 3/109 (2%) Frame = +2 Query: 278 NSSQRISDIETSRNKQFSANLRHRSSRQKQFPVNLRQRTISKTETVTSSSPIVQLSENHQ 457 +S ++ S R++ S + R RS +++ + R R+ S+ + +S S ++ S+ + Sbjct: 266 HSRKKKSRKHRHRSRSSSLSSRRRSKHKRK---SKRDRSRSRDRS-SSKSKSLRRSKKYS 321 Query: 458 *TRQLPVKPRYRSRNPSKKQPSSTSAQTDSKKHYYTTRKQP---YRPGR 595 +R + R RSR+ S + + +++ +KH +T P YR G+ Sbjct: 322 RSRSRSSERRRRSRSRSTEHRYRSRSRSPRRKHRRSTSTSPSRRYRSGK 370 >SB_9683| Best HMM Match : RCSD (HMM E-Value=2.8) Length = 232 Score = 30.3 bits (65), Expect = 1.6 Identities = 27/109 (24%), Positives = 46/109 (42%), Gaps = 3/109 (2%) Frame = +2 Query: 263 PFIGKNSSQRISDIETSRNKQFSANLRHRSSRQKQ-FPVNLRQRTISK-TETVTSSSPIV 436 P I S I + S + ++R +K F ++ + + T T+T++S Sbjct: 20 PSIQATHSSSIKTRDASLSSSLMPSIRSVVVTEKTTFATSMNTKAFNTMTNTMTTTSSFT 79 Query: 437 QLSENHQ*-TRQLPVKPRYRSRNPSKKQPSSTSAQTDSKKHYYTTRKQP 580 SE + T + P YR+ NP+ S TS +S K +T+ P Sbjct: 80 SKSETRESVTHSMSRFPAYRTVNPTPVTQSPTSHSHESIKTSSSTKNIP 128 >SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 336 Score = 30.3 bits (65), Expect = 1.6 Identities = 23/89 (25%), Positives = 38/89 (42%), Gaps = 1/89 (1%) Frame = +2 Query: 314 RNKQFSANLRHRSSRQKQFPVNLRQRTISKTETVTSSSPIVQLSENHQ*TRQLPVKPRY- 490 R A+ R SR + R+R+ S S SP + +R + R+ Sbjct: 211 RRSHSPAHHRRSRSRSRSRSPRRRRRSRSPRRRRRSRSPSPHHRSHRSRSRSRSPRRRHS 270 Query: 491 RSRNPSKKQPSSTSAQTDSKKHYYTTRKQ 577 RSR+P+ ++ S S + KKH +K+ Sbjct: 271 RSRSPTHRRHRSRSHSPEKKKHKKKEKKE 299 >SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = +2 Query: 269 IGKNSSQRISDIETSRNKQFSANLRHRSSRQKQFPVNLRQRTISKTETVTSSSPI 433 +G D ET K+ SAN+RH ++ + + R R +T T SPI Sbjct: 93 VGLGKKDHSVDEETIEEKEESANIRHAAAGVYRTRNDPRTRNYPRTRNNTEESPI 147 >SB_38269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 29.9 bits (64), Expect = 2.1 Identities = 26/92 (28%), Positives = 36/92 (39%) Frame = +2 Query: 272 GKNSSQRISDIETSRNKQFSANLRHRSSRQKQFPVNLRQRTISKTETVTSSSPIVQLSEN 451 G N S+R+ FS + H +L+ I TE V Q EN Sbjct: 546 GSNESKRVK--AEYNEGAFSPRIEHFDG----IAPDLKLENIKDTELVNMPHRTGQPEEN 599 Query: 452 HQ*TRQLPVKPRYRSRNPSKKQPSSTSAQTDS 547 H +K RS SK++PSS A+ +S Sbjct: 600 HPSLSPPDLKDAPRSEAHSKRRPSSARARANS 631 >SB_34601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1391 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = +1 Query: 364 TVPSESSTKNHQQDRNSYQQFSNSTVIRKPPVNQTVTCETSLQK-PKPIEETA 519 ++P ES+T Q RNS S T+ PP Q + ++ + P P T+ Sbjct: 609 SLPGESNTYQSQVHRNSTGSTSQQTLYSNPPPGQPINVQSQIYGFPGPTGSTS 661 >SB_39858| Best HMM Match : Spectrin (HMM E-Value=2.6e-05) Length = 3397 Score = 29.9 bits (64), Expect = 2.1 Identities = 19/59 (32%), Positives = 27/59 (45%) Frame = +3 Query: 390 EPSARQKQLPAVLQ*YSYQKTTSEPDSYL*NLATEAETHRRNSRLLPAHKQTAKNIITR 566 EPS ++K L + + K EPDS ++ ET R + H + K IITR Sbjct: 356 EPSWKKKPLKMSI---ASSKIDKEPDSEAVGVSYPLETSEREKEFVDVHGRIIKTIITR 411 >SB_20713| Best HMM Match : Pkinase (HMM E-Value=0) Length = 492 Score = 29.9 bits (64), Expect = 2.1 Identities = 18/57 (31%), Positives = 30/57 (52%) Frame = +1 Query: 286 SANLRHRNIKKQTVLSESPTQIIKTETVPSESSTKNHQQDRNSYQQFSNSTVIRKPP 456 SAN+ HR+IK +L +S T ++K ++ + + D + Y S ST+ K P Sbjct: 141 SANVLHRDIKPSNLLVDSETLMLKIGDF-GQTRVVDPEFDHDGYLTHSPSTLWYKAP 196 >SB_18653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 417 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +1 Query: 319 QTVLSESPTQIIKTETVPSESSTKNHQQDRNSYQQFSNSTVIRKPP 456 Q ++E+ TQI+K V + S + HQ N + ST +R P Sbjct: 81 QLRMNENITQIVKFTVVVQDISLRPHQTSTNIIIPYGGSTTLRVSP 126 >SB_12669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 29.5 bits (63), Expect = 2.8 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 4/56 (7%) Frame = +2 Query: 248 KYKGWPFIGKNSSQRISDIETSRNKQFSANLRH----RSSRQKQFPVNLRQRTISK 403 K K P + K S +R + KQ+ + + H + RQKQ NL++R++SK Sbjct: 256 KQKDDPKLIKKSLKRREKQKEKSRKQWKSRIEHTQKQKEDRQKQRQKNLKERSLSK 311 >SB_51476| Best HMM Match : Ion_trans (HMM E-Value=6.29996e-41) Length = 823 Score = 29.1 bits (62), Expect = 3.7 Identities = 20/71 (28%), Positives = 32/71 (45%), Gaps = 1/71 (1%) Frame = +2 Query: 341 RHRSSRQKQFPVNLRQRTISKTETVTSSSPIVQLSENHQ*TRQLPVKPRY-RSRNPSKKQ 517 R +S P+N+ +R ++VTS RQLP +P Y +SRN S+ Sbjct: 710 RLKSHAHAGHPINVHRRIRPVQKSVTSDLSTKPTGSRGMPRRQLPQQPTYGQSRNGSQIS 769 Query: 518 PSSTSAQTDSK 550 S S +++ Sbjct: 770 LSGKSPYVENR 780 >SB_46439| Best HMM Match : RVT_1 (HMM E-Value=4.8e-25) Length = 1641 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +1 Query: 268 YRQKQFSANLRHRNIKKQTVLSESPTQIIKTETVPSESSTKN 393 YR+ SA L+ +K S +P Q++ T +ES+TKN Sbjct: 817 YRKLPKSAKLKQSGVKIFAYQSTNPLQVLGKFTAITESTTKN 858 >SB_21143| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.42) Length = 870 Score = 29.1 bits (62), Expect = 3.7 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = +1 Query: 394 HQQDRNSYQQFSNSTVIRKPPVNQTVTCETSLQKPKPIEETAVFYQRTNRQQK--TLLHD 567 H+Q+R +Y + I + T + +L+K + E TAV Q T R+Q+ TLL + Sbjct: 660 HEQERIAYDHGTREAKI-------SATAKKNLEKARAAELTAVNQQATQREQQLTTLLQE 712 Query: 568 SE 573 +E Sbjct: 713 TE 714 >SB_50370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1059 Score = 28.7 bits (61), Expect = 4.9 Identities = 21/78 (26%), Positives = 36/78 (46%) Frame = +2 Query: 347 RSSRQKQFPVNLRQRTISKTETVTSSSPIVQLSENHQ*TRQLPVKPRYRSRNPSKKQPSS 526 R + P++ +S ++ +S P V NH Q+P R ++ + QPS+ Sbjct: 924 RGANGSPLPISTMALPVSFVNSLINSHPSV----NHTSRLQIPTS-RLQTHTTTI-QPST 977 Query: 527 TSAQTDSKKHYYTTRKQP 580 T QT + KH+ T + P Sbjct: 978 TRFQTPAAKHHTTVLQTP 995 >SB_7782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 28.7 bits (61), Expect = 4.9 Identities = 21/90 (23%), Positives = 38/90 (42%) Frame = +1 Query: 292 NLRHRNIKKQTVLSESPTQIIKTETVPSESSTKNHQQDRNSYQQFSNSTVIRKPPVNQTV 471 +L+ + K+ P + E SS +N +++ N Y +N+ + PP N Sbjct: 105 SLKSKAKSKKNKSRTLPMTVDSNEESSDTSSLENKKKNLNKYPVKNNADRLLVPPRNDLN 164 Query: 472 TCETSLQKPKPIEETAVFYQRTNRQQKTLL 561 E K + E A ++ R++K LL Sbjct: 165 DTEEDSLSKKQLREAA---KQKKREEKILL 191 >SB_56888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/45 (24%), Positives = 21/45 (46%) Frame = +1 Query: 454 PVNQTVTCETSLQKPKPIEETAVFYQRTNRQQKTLLHDSETAIQT 588 P +T ++ P P+ + A FYQ +++ D E ++ T Sbjct: 73 PQRMVITERGEIRSPTPLNKAAEFYQSFSKENLFTNEDEENSVDT 117 >SB_43849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -3 Query: 276 LPINGHPLYLFQYPISRRAIDAPLSGVP 193 LPI G PL + YP S + P SG+P Sbjct: 689 LPIIGIPLPIIGYPTSYHRVVFPSSGIP 716 >SB_37844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 274 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/45 (24%), Positives = 21/45 (46%) Frame = +1 Query: 454 PVNQTVTCETSLQKPKPIEETAVFYQRTNRQQKTLLHDSETAIQT 588 P +T ++ P P+ + A FYQ +++ D E ++ T Sbjct: 169 PQRMVITERGEIRSPTPLNKAAEFYQSFSKENLFTNEDEENSVDT 213 >SB_31972| Best HMM Match : RVT_1 (HMM E-Value=2.4e-14) Length = 1242 Score = 28.3 bits (60), Expect = 6.5 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +1 Query: 268 YRQKQFSANLRHRNIKKQTVLSESPTQIIKTETVPSESSTKN 393 YR+ SA L +K S +P Q++ T +ES+TKN Sbjct: 311 YRKLPKSAKLEQSGVKIFAYQSTNPLQVLGKFTAITESTTKN 352 >SB_17670| Best HMM Match : RVT_1 (HMM E-Value=6.1e-25) Length = 1271 Score = 28.3 bits (60), Expect = 6.5 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +1 Query: 268 YRQKQFSANLRHRNIKKQTVLSESPTQIIKTETVPSESSTKN 393 YR+ SA L +K S +P Q++ T +ES+TKN Sbjct: 304 YRKLPKSAKLEQSGVKIFAYQSTNPLQVLGKFTAITESTTKN 345 >SB_47161| Best HMM Match : rve (HMM E-Value=1.8e-22) Length = 1046 Score = 28.3 bits (60), Expect = 6.5 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +1 Query: 268 YRQKQFSANLRHRNIKKQTVLSESPTQIIKTETVPSESSTKN 393 YR+ SA L +K S +P Q++ T +ES+TKN Sbjct: 326 YRKLPKSAKLEQSGVKIFAYQSTNPLQVLGKFTAITESTTKN 367 >SB_34910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2147 Score = 28.3 bits (60), Expect = 6.5 Identities = 33/141 (23%), Positives = 61/141 (43%) Frame = +1 Query: 172 TTVTYRSRDPRKWRVDSASRDGVLK*I*RMAIYRQKQFSANLRHRNIKKQTVLSESPTQI 351 T+ T SR + V SR + + + + Q SA + + +V ESP+ Sbjct: 1193 TSATQESRSSQVTSVTQESRSSQVTSVTQESRSSQVT-SATQEPPSTQATSVTQESPSTQ 1251 Query: 352 IKTETVPSESSTKNHQQDRNSYQQFSNSTVIRKPPVNQTVTCETSLQKPKPIEETAVFYQ 531 + + T S SS + Y Q ++V ++PP Q VT T Q+ + + T+V + Sbjct: 1252 VTSATQESPSSQVTSATQESRYSQV--TSVTQEPPSTQ-VTSAT--QESRSSQVTSVTQE 1306 Query: 532 RTNRQQKTLLHDSETAIQTGS 594 + Q + +S ++ T + Sbjct: 1307 SRSSQVTSATQESPSSQVTSA 1327 >SB_17276| Best HMM Match : E-MAP-115 (HMM E-Value=0.57) Length = 618 Score = 28.3 bits (60), Expect = 6.5 Identities = 18/92 (19%), Positives = 40/92 (43%), Gaps = 1/92 (1%) Frame = +1 Query: 313 KKQTVLSESPTQIIKTETVPSESSTKNHQQDRNSYQQFSNSTVIRKPPVNQTVTCETSLQ 492 K+Q + ++ + + + + +N QQD N +Q +N + + ++ T + Q Sbjct: 276 KRQEPAHQQDLEVQEAQQNVDDLTRQNRQQDVNIDEQDNNENALLEQKMSDKATMRITCQ 335 Query: 493 KPKPIEETA-VFYQRTNRQQKTLLHDSETAIQ 585 + EE QR R+++ H + +Q Sbjct: 336 QNMSAEEPEDKKMQRQTRKRQEPPHQQDVEVQ 367 >SB_8541| Best HMM Match : Vicilin_N (HMM E-Value=1.7) Length = 165 Score = 28.3 bits (60), Expect = 6.5 Identities = 18/92 (19%), Positives = 40/92 (43%), Gaps = 1/92 (1%) Frame = +1 Query: 313 KKQTVLSESPTQIIKTETVPSESSTKNHQQDRNSYQQFSNSTVIRKPPVNQTVTCETSLQ 492 K+Q + ++ + + + + +N QQD N +Q +N + + ++ T + Q Sbjct: 17 KRQEPAHQQDLEVQEAQQNVDDLTRQNRQQDVNIDEQDNNENALLEQKMSDKATMRITCQ 76 Query: 493 KPKPIEETA-VFYQRTNRQQKTLLHDSETAIQ 585 + EE QR R+++ H + +Q Sbjct: 77 QNMSAEEPEDKKMQRQTRKRQEPPHQQDVEVQ 108 >SB_4115| Best HMM Match : Homeobox (HMM E-Value=9.4e-08) Length = 267 Score = 28.3 bits (60), Expect = 6.5 Identities = 23/108 (21%), Positives = 49/108 (45%), Gaps = 4/108 (3%) Frame = +1 Query: 145 NRNDLWSAFTTVTYRSRDPRKWRVDSASRDGVLK*I*RMAIYRQKQFSANLRHRNIKKQT 324 NRN L+ ++ + ++W A R+ + + + ++Y+ S N + Sbjct: 110 NRNKLFITMLRDIRKADERQRWAHKRALRESLDQSVTATSLYQPFGTSLNQSLAATSLEA 169 Query: 325 VLSES----PTQIIKTETVPSESSTKNHQQDRNSYQQFSNSTVIRKPP 456 LS+S P T+++PS + ++H +D QQF++ + + P Sbjct: 170 SLSQSVTATPLYQPLTQSLPSNNLHQSHHEDSFLDQQFADQSPWQPTP 217 >SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) Length = 440 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +2 Query: 464 RQLPVKPRYRSRNPSKKQPSSTSAQTDSKKHYYTTRKQPYRPGR 595 R++ PR RSR P K+ S +K +T +K+ P R Sbjct: 205 RKMLRSPRKRSRTPRKRSRSPRKRSRSPRKGSHTPKKRSRSPRR 248 >SB_25899| Best HMM Match : Ribonuc_2-5A (HMM E-Value=0) Length = 603 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/47 (27%), Positives = 21/47 (44%) Frame = +2 Query: 413 VTSSSPIVQLSENHQ*TRQLPVKPRYRSRNPSKKQPSSTSAQTDSKK 553 V SP+V+L H + +P + + NP+ T Q D+ K Sbjct: 72 VEEGSPLVELQMTHIPDKLMPFYMNHHTHNPNNSPTPPTPKQIDNAK 118 >SB_31408| Best HMM Match : ENTH (HMM E-Value=0) Length = 1080 Score = 27.9 bits (59), Expect = 8.6 Identities = 17/60 (28%), Positives = 25/60 (41%), Gaps = 3/60 (5%) Frame = +1 Query: 292 NLRHRN---IKKQTVLSESPTQIIKTETVPSESSTKNHQQDRNSYQQFSNSTVIRKPPVN 462 N++ RN K T S SP I + VP+ + K Q N Q +++ P N Sbjct: 917 NMKQRNDIVSSKSTTWSNSPVNINLDDLVPTLNREKPQQPSMNQLQSQQPGSIMMASPYN 976 >SB_24848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1506 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/50 (28%), Positives = 21/50 (42%) Frame = +2 Query: 395 ISKTETVTSSSPIVQLSENHQ*TRQLPVKPRYRSRNPSKKQPSSTSAQTD 544 + +T+T T P+ LS N L R R+ P KK + S + Sbjct: 342 LERTQTQTQRVPVTSLSPNKSLFEHLRTNFRNRAEQPDKKSTGTGSGSIE 391 >SB_6746| Best HMM Match : rve (HMM E-Value=2.4) Length = 488 Score = 27.9 bits (59), Expect = 8.6 Identities = 23/77 (29%), Positives = 35/77 (45%) Frame = +1 Query: 313 KKQTVLSESPTQIIKTETVPSESSTKNHQQDRNSYQQFSNSTVIRKPPVNQTVTCETSLQ 492 K QT ++PT K +T + ++ NHQ +N Q ++ T + P NQ +T Q Sbjct: 346 KNQT--GKNPTNQAKNQTGQNSTNQANHQTGQNPTNQANHQT--GQNPTNQAKN-QTG-Q 399 Query: 493 KPKPIEETAVFYQRTNR 543 P E RTN+ Sbjct: 400 NPTNQAENQTGQNRTNQ 416 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,268,718 Number of Sequences: 59808 Number of extensions: 451846 Number of successful extensions: 2092 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 1810 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2079 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -