BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30680 (311 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1193 - 28298656-28298754,28299303-28299377,28299456-282995... 42 1e-04 07_03_0723 + 20954827-20954905,20954974-20956277 29 0.77 03_01_0122 + 954356-954491,954877-955030,955141-955231,955732-95... 29 0.77 03_05_0319 - 23064997-23065443 28 1.8 03_05_0317 - 23056409-23056855 28 1.8 08_02_0660 - 19768165-19769394,19770500-19770752,19771307-197713... 26 7.2 03_01_0423 + 3240224-3240394,3241464-3241628,3242322-3242339,324... 25 9.5 >06_03_1193 - 28298656-28298754,28299303-28299377,28299456-28299544, 28299679-28299760,28300385-28300474,28300557-28300655, 28300733-28300852,28300968-28301084,28301174-28301309, 28301415-28301584,28301744-28301947,28302032-28302157, 28302841-28303101,28303215-28303229 Length = 560 Score = 41.5 bits (93), Expect = 1e-04 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = +3 Query: 3 LVKLNAVNTACKATAQILSVDETIKNVKSGEEAQ 104 +VK+NA+N A +A ILSVDET+KN KS E AQ Sbjct: 501 VVKINAINAATEAACLILSVDETVKNPKS-ESAQ 533 >07_03_0723 + 20954827-20954905,20954974-20956277 Length = 460 Score = 29.1 bits (62), Expect = 0.77 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +1 Query: 169 LITDYDHLKSLASTLSRF*YYTYS 240 LI D+DH K L TLS F Y ++S Sbjct: 136 LIADHDHRKKLPQTLSGFFYTSFS 159 >03_01_0122 + 954356-954491,954877-955030,955141-955231,955732-955806, 955884-955972,956084-956202,956338-956478,956817-956893, 958615-959217 Length = 494 Score = 29.1 bits (62), Expect = 0.77 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +1 Query: 7 SSLTP*IPPARPPLRFYQWMRPSRMSRAVKRRRCLVAAWTALVWNRTRQWLIT 165 S+ +P A P LR RPSR S + ++ AL + RQW++T Sbjct: 8 SAASPSTSSAAPRLRHVARRRPSRRSACPRSAASRLSIMAALGEDPIRQWILT 60 >03_05_0319 - 23064997-23065443 Length = 148 Score = 27.9 bits (59), Expect = 1.8 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 58 QWMRPSRMSRAVKRRRCLVAAWTALVWNRTRQ 153 +WMR + R +KRRR + T W+R+R+ Sbjct: 8 RWMRMAGRRRWLKRRRSGACSRTLSAWSRSRR 39 >03_05_0317 - 23056409-23056855 Length = 148 Score = 27.9 bits (59), Expect = 1.8 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 58 QWMRPSRMSRAVKRRRCLVAAWTALVWNRTRQ 153 +WMR + R +KRRR + T W+R+R+ Sbjct: 8 RWMRMAGRRRWLKRRRSGACSRTLSAWSRSRR 39 >08_02_0660 - 19768165-19769394,19770500-19770752,19771307-19771372, 19771524-19771588,19773265-19773343,19773920-19774293 Length = 688 Score = 25.8 bits (54), Expect = 7.2 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +1 Query: 79 MSRAVKRRRCLVAAWTALVWNRTRQW 156 M+ A R C WT L W R+ W Sbjct: 17 MAHAPDTRTCPSQEWTFLAWGRSWTW 42 >03_01_0423 + 3240224-3240394,3241464-3241628,3242322-3242339, 3242494-3242836,3244138-3248540,3248928-3249107, 3249108-3250892,3251055-3252173 Length = 2727 Score = 25.4 bits (53), Expect = 9.5 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +3 Query: 3 LVKLNAVNTACKATAQILSVDETIK 77 LVKLN NT C+ ++ S++ I+ Sbjct: 744 LVKLNLENTVCELKKEVTSLERKIQ 768 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,310,771 Number of Sequences: 37544 Number of extensions: 143074 Number of successful extensions: 349 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 343 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 349 length of database: 14,793,348 effective HSP length: 71 effective length of database: 12,127,724 effective search space used: 388087168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -