BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30678 (647 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC32F12.04 |tug1|gtb1|gamma-tubulin|Schizosaccharomyces pombe|... 26 4.1 SPBC3E7.01 |fab1|ste12, SPBC6B1.11c|1-phosphatidylinositol-3-pho... 26 5.4 SPAC4D7.02c |||glycerophosphoryl diester phosphodiesterase |Schi... 26 5.4 SPBP8B7.07c |set6||histone lysine methyltransferase Set6 |Schizo... 25 7.1 SPAC30D11.06c |||DUF300 family protein|Schizosaccharomyces pombe... 25 7.1 SPAC1071.06 |arp9||SWI/SNF and RSC complex subunit Arp9|Schizosa... 25 9.4 >SPBC32F12.04 |tug1|gtb1|gamma-tubulin|Schizosaccharomyces pombe|chr 2|||Manual Length = 446 Score = 26.2 bits (55), Expect = 4.1 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -3 Query: 159 MRNGYCSSQLGSRLFSRQCYAHG 91 ++ G C +Q+GS+ + + C HG Sbjct: 8 LQAGQCGNQIGSQFWQQLCLEHG 30 >SPBC3E7.01 |fab1|ste12, SPBC6B1.11c|1-phosphatidylinositol-3-phosphate 5-kinase Fab1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1932 Score = 25.8 bits (54), Expect = 5.4 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +1 Query: 424 LNQLKLYQNTRQKLLKKVK 480 LNQ+ YQ R KLLK VK Sbjct: 843 LNQVNYYQFIRNKLLKDVK 861 >SPAC4D7.02c |||glycerophosphoryl diester phosphodiesterase |Schizosaccharomyces pombe|chr 1|||Manual Length = 319 Score = 25.8 bits (54), Expect = 5.4 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -1 Query: 524 SEWSHLFFGFS*RACFTFF 468 SEW H+ +GF RA F FF Sbjct: 295 SEWLHMIYGFL-RAQFVFF 312 >SPBP8B7.07c |set6||histone lysine methyltransferase Set6 |Schizosaccharomyces pombe|chr 2|||Manual Length = 483 Score = 25.4 bits (53), Expect = 7.1 Identities = 12/35 (34%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +2 Query: 107 CRLN-SLEPNWELQYPFLMISLKLQVNLKKTQQQF 208 CRLN S +PN ++ + ++ L + ++KK +Q F Sbjct: 190 CRLNHSCDPNCQIIFDGAIVQLVSKRDIKKDEQLF 224 >SPAC30D11.06c |||DUF300 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 426 Score = 25.4 bits (53), Expect = 7.1 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = +2 Query: 20 CLFLLKISFISK*RSWRSSVY*NLPCA*HCRLNSLEPNWELQYPFLMISLK 172 C F L I ++ R+ S++ +LP LN L+ + +L P+ +S+K Sbjct: 81 CFFCLLIDYLGGERAAVISLHGHLPRPRLWPLNYLQDDIDLSDPYTFLSIK 131 >SPAC1071.06 |arp9||SWI/SNF and RSC complex subunit Arp9|Schizosaccharomyces pombe|chr 1|||Manual Length = 523 Score = 25.0 bits (52), Expect = 9.4 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -1 Query: 638 KRQGSE*FHQQSLVHQML-LPVQLVPCVWGLQ*IWQVLISEWSHLF 504 K GS FH + V LP ++ P G W+ L + W HL+ Sbjct: 89 KNMGSS-FHSECKVDDFTPLPNEIQPIQRGRVVDWEALKAFWKHLY 133 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,227,172 Number of Sequences: 5004 Number of extensions: 37165 Number of successful extensions: 98 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 98 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 291768710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -