BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30675X (493 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 27 0.092 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 23 1.5 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 2.6 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 2.6 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 2.6 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 2.6 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 6.1 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 21 8.0 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 8.0 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.0 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.0 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 27.1 bits (57), Expect = 0.092 Identities = 16/66 (24%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Frame = -1 Query: 472 FVLAFSAFFLWMYSMSTRLFLNTLPFAFM*SEWYRCLSIFLAVLYFRSNFLKTLC-LCTH 296 + L FS ++ + F +++ F SE + +++ YFR + KT C L T Sbjct: 353 YTLVFSVLKQYVMQQQVKNFRHSVRSVFFLSEIFGLVNLKYRETYFRLSKTKTFCTLVTA 412 Query: 295 SSFCGI 278 +C + Sbjct: 413 LVYCSL 418 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 23.0 bits (47), Expect = 1.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 156 ILDHLTDVLSGVGVCDLI 103 IL H+ SG+ +CDLI Sbjct: 252 ILWHIVGTFSGIFLCDLI 269 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.2 bits (45), Expect = 2.6 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -2 Query: 282 AYAHWLYLFFTKATVTTLSTCFCVF 208 A++H+L +FFT+ T+ T+ +F Sbjct: 163 AFSHFLIVFFTE-TLHTVGIALLIF 186 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.2 bits (45), Expect = 2.6 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -2 Query: 282 AYAHWLYLFFTKATVTTLSTCFCVF 208 A++H+L +FFT+ T+ T+ +F Sbjct: 163 AFSHFLIVFFTE-TLHTVGIALLIF 186 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.2 bits (45), Expect = 2.6 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -2 Query: 282 AYAHWLYLFFTKATVTTLSTCFCVF 208 A++H+L +FFT+ T+ T+ +F Sbjct: 163 AFSHFLIVFFTE-TLHTVGIALLIF 186 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.2 bits (45), Expect = 2.6 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -2 Query: 282 AYAHWLYLFFTKATVTTLSTCFCVF 208 A++H+L +FFT+ T+ T+ +F Sbjct: 163 AFSHFLIVFFTE-TLHTVGIALLIF 186 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.0 bits (42), Expect = 6.1 Identities = 11/40 (27%), Positives = 17/40 (42%) Frame = -3 Query: 152 LIILRMFCLELVFAISLISFGSNHTFFLPHRITEAASLFC 33 L I +C ++F + L+ + FF I LFC Sbjct: 144 LCIYYFYCAFIIFTVHLLFLLCIYHFFCAFIIFTMHLLFC 183 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 20.6 bits (41), Expect = 8.0 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +2 Query: 254 KKRYSQCAY 280 KKR+SQC Y Sbjct: 120 KKRWSQCMY 128 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 20.6 bits (41), Expect = 8.0 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +2 Query: 254 KKRYSQCAY 280 KKR+SQC Y Sbjct: 434 KKRWSQCMY 442 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 20.6 bits (41), Expect = 8.0 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +2 Query: 254 KKRYSQCAY 280 KKR+SQC Y Sbjct: 667 KKRWSQCMY 675 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 20.6 bits (41), Expect = 8.0 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +2 Query: 254 KKRYSQCAY 280 KKR+SQC Y Sbjct: 667 KKRWSQCMY 675 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,197 Number of Sequences: 336 Number of extensions: 2753 Number of successful extensions: 14 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11525470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -