BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30674 (601 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY846632-1|AAW31598.1| 412|Anopheles gambiae SAGLIN protein. 25 1.4 AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 23 10.0 >AY846632-1|AAW31598.1| 412|Anopheles gambiae SAGLIN protein. Length = 412 Score = 25.4 bits (53), Expect = 1.4 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 77 QRQPERRHRAYSAVPPLYIHAA 12 QRQ E+ HR Y+A +HAA Sbjct: 105 QRQMEQEHRQYAATLEEQLHAA 126 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 22.6 bits (46), Expect = 10.0 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = -1 Query: 244 RTGTAITESTPARSEACRSPINICTTRCAARLGASEGVVARGGTR 110 R T + S R A S +N C TRCA + V++ TR Sbjct: 41 RACTVMVSSDRKRLTAS-SAVNACLTRCAFTDAVTTVEVSKYSTR 84 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 601,007 Number of Sequences: 2352 Number of extensions: 11803 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58029966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -