BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30674 (601 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 27 0.19 AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 23 3.0 AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 21 7.0 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 26.6 bits (56), Expect = 0.19 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -2 Query: 249 LHGQAQRSLSPPPRGPKPAAR 187 L G++Q+S + PP GP PA + Sbjct: 373 LSGRSQKSTTGPPPGPTPAQK 393 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = -2 Query: 177 FVQRGAPLDSALRRGWWRAAGLDNTGEPRLR 85 F++ + S L+R W + G+DN R + Sbjct: 19 FIRHQSDRYSKLKRNWRKPKGIDNRVRRRFK 49 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 21.4 bits (43), Expect = 7.0 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +3 Query: 216 VDSVIAVPVRGVWGAGPASDVRPASLCESS 305 + + +PV + GA AS+V CE++ Sbjct: 138 ISKQLHIPVSVLMGANLASEVANEMFCETT 167 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,342 Number of Sequences: 438 Number of extensions: 3705 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17604432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -