BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30673 (408 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57216| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_35019| Best HMM Match : 7tm_1 (HMM E-Value=4.2039e-45) 27 5.9 SB_27731| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_7572| Best HMM Match : GILT (HMM E-Value=2.4) 27 5.9 >SB_57216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 27.1 bits (57), Expect = 5.9 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -2 Query: 119 SYITCIFAFLVVVNNKR 69 S++TC+F FL+V+ N R Sbjct: 6 SHLTCLFCFLLVLGNSR 22 >SB_35019| Best HMM Match : 7tm_1 (HMM E-Value=4.2039e-45) Length = 412 Score = 27.1 bits (57), Expect = 5.9 Identities = 12/42 (28%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = -1 Query: 288 VYYEKREIKTNVFLILNKN---NIFAMIIIARRNTSITLILF 172 + Y+KR+++ VF I+N++ +F +++ R I L++F Sbjct: 270 IRYKKRKVRAKVFRIINESRNGGVFYLVLKVVRMLVIILVVF 311 >SB_27731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 27.1 bits (57), Expect = 5.9 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -3 Query: 235 EQYFRNDNNSTKKHVNNIDIVFEVD 161 + F N N STK +NNIDI + ++ Sbjct: 8 DHLFINTNTSTKVDINNIDINYNMN 32 >SB_7572| Best HMM Match : GILT (HMM E-Value=2.4) Length = 151 Score = 27.1 bits (57), Expect = 5.9 Identities = 12/42 (28%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = -1 Query: 288 VYYEKREIKTNVFLILNKN---NIFAMIIIARRNTSITLILF 172 + Y+KR+++ VF I+N++ +F +++ R I L++F Sbjct: 9 IRYKKRKVRAKVFRIINESRNGGVFYLVLKVVRMLVIILVVF 50 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,324,950 Number of Sequences: 59808 Number of extensions: 127435 Number of successful extensions: 206 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 185 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 204 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 740151420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -