BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30672 (620 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 2.1 DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory pro... 22 3.6 DQ855494-1|ABH88181.1| 99|Tribolium castaneum chemosensory pro... 21 6.3 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 23.0 bits (47), Expect = 2.1 Identities = 10/43 (23%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +3 Query: 378 VFGQSGAGNNW-AKGHYTEGAELVDDVLDVVRKECENCDCLQG 503 + + G N + A+ Y G+E ++ + +C C C G Sbjct: 839 ILAEGGCPNLYDARKPYVNGSEYHPSIVSLGEYKCVTCKCENG 881 >DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory protein 11 protein. Length = 127 Score = 22.2 bits (45), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = +3 Query: 414 KGHYT-EGAELVDDVLDVVRKECENC 488 KG T +GAEL + D + EC C Sbjct: 53 KGKCTPDGAELKRHLPDALHTECSKC 78 >DQ855494-1|ABH88181.1| 99|Tribolium castaneum chemosensory protein 8 protein. Length = 99 Score = 21.4 bits (43), Expect = 6.3 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = +3 Query: 432 GAELVDDVLDVVRKECENCDCLQ 500 G ++ + +++ K CE CD Q Sbjct: 49 GNQIKGALPEIIGKNCERCDSRQ 71 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,581 Number of Sequences: 336 Number of extensions: 2151 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15875032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -