BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30669 (628 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 21 6.4 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 21 6.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 8.4 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 21.4 bits (43), Expect = 6.4 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -1 Query: 346 VMLNNARCWLLEYL*HP 296 V N R WL ++L HP Sbjct: 188 VATNILRAWLFQHLTHP 204 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 21.4 bits (43), Expect = 6.4 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -1 Query: 346 VMLNNARCWLLEYL*HP 296 V N R WL ++L HP Sbjct: 344 VATNILRAWLFQHLTHP 360 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 8.4 Identities = 9/34 (26%), Positives = 15/34 (44%) Frame = +3 Query: 186 LLEDVFNLSPAGRDIELEIPKFEYAVDWTLILFY 287 LL + S A D ++P +DW ++ Y Sbjct: 2480 LLSAAVSPSKAVMDAGYDVPALSQYLDWIAVMTY 2513 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,563 Number of Sequences: 336 Number of extensions: 3016 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16083914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -