BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30668 (728 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 23 7.3 AY146745-1|AAO12105.1| 153|Anopheles gambiae odorant-binding pr... 23 7.3 AJ697725-1|CAG26918.1| 153|Anopheles gambiae putative odorant-b... 23 7.3 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 7.3 AF437886-1|AAL84181.1| 153|Anopheles gambiae odorant binding pr... 23 7.3 AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant r... 23 7.3 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 23.4 bits (48), Expect = 7.3 Identities = 8/20 (40%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = -1 Query: 530 IW-YWLRALVIPCALFPNEV 474 +W +WLR+ V+PC N + Sbjct: 8 LWQHWLRSSVLPCGTTSNRL 27 >AY146745-1|AAO12105.1| 153|Anopheles gambiae odorant-binding protein AgamOBP3 protein. Length = 153 Score = 23.4 bits (48), Expect = 7.3 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -1 Query: 380 MSCQQSCLYHQDQ*VLPTYRFHHHQINCMSP 288 + C +CL+HQ V FH+ +I P Sbjct: 79 LKCYMNCLFHQAGVVNDKGEFHYVKIQDFLP 109 >AJ697725-1|CAG26918.1| 153|Anopheles gambiae putative odorant-binding protein OBPjj15 protein. Length = 153 Score = 23.4 bits (48), Expect = 7.3 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -1 Query: 380 MSCQQSCLYHQDQ*VLPTYRFHHHQINCMSP 288 + C +CL+HQ V FH+ +I P Sbjct: 79 LKCYMNCLFHQAGVVNDKGEFHYVKIQDFLP 109 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.4 bits (48), Expect = 7.3 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +2 Query: 665 SSRTRCDVCHA 697 S+R CDVCHA Sbjct: 84 SNRKSCDVCHA 94 >AF437886-1|AAL84181.1| 153|Anopheles gambiae odorant binding protein protein. Length = 153 Score = 23.4 bits (48), Expect = 7.3 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -1 Query: 380 MSCQQSCLYHQDQ*VLPTYRFHHHQINCMSP 288 + C +CL+HQ V FH+ +I P Sbjct: 79 LKCYMNCLFHQAGVVNDKGEFHYVKIQDFLP 109 >AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant receptor Or4 protein. Length = 397 Score = 23.4 bits (48), Expect = 7.3 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -1 Query: 536 VRIWYWLRALVIPCALFPNEVNFCIPPSGVRHFE 435 V ++YW+ + CA + N P V+H E Sbjct: 138 VTLFYWIAPIPSICAHYYRSTNSTEPVRFVQHLE 171 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 678,527 Number of Sequences: 2352 Number of extensions: 13282 Number of successful extensions: 22 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -