BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30667 (622 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 21 9.7 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 9.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 9.7 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 21.0 bits (42), Expect = 9.7 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -2 Query: 180 RSTSTVGLPRESKI*RALIDFITIFNTELDFLKLSV 73 R ++ +P KI LID T DFL ++V Sbjct: 79 RQPFSLFIPAHRKIAARLIDIFMGMRTYEDFLSVAV 114 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.0 bits (42), Expect = 9.7 Identities = 6/14 (42%), Positives = 8/14 (57%) Frame = +1 Query: 193 WLVPGSCTLWCLHW 234 W VP +W L+W Sbjct: 596 WYVPSLDQVWILNW 609 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.0 bits (42), Expect = 9.7 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -3 Query: 251 QELHEHQWRHQRVQLPGTSQ 192 Q+LH HQ H + Q Q Sbjct: 812 QQLHHHQSTHPQAQAQAQPQ 831 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,789 Number of Sequences: 438 Number of extensions: 2938 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18460203 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -