BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30665 (504 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1827.04 |||ankyrin repeat protein, unknown biological role|S... 25 6.5 SPAC17A2.06c |vps8||WD repeat protein Vps8|Schizosaccharomyces p... 25 6.5 >SPCC1827.04 |||ankyrin repeat protein, unknown biological role|Schizosaccharomyces pombe|chr 3|||Manual Length = 600 Score = 25.0 bits (52), Expect = 6.5 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +2 Query: 251 PREFAYIGPDGVTYAVTYVANEGGFQPSAPHIPKA*VNRT 370 P + A G +A +NE F P PH+PK +T Sbjct: 198 PLQLAMFMVGGGHFAAMIASNE--FNPRDPHVPKVLAQKT 235 >SPAC17A2.06c |vps8||WD repeat protein Vps8|Schizosaccharomyces pombe|chr 1|||Manual Length = 1272 Score = 25.0 bits (52), Expect = 6.5 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -2 Query: 416 KTFQMNEYFWTRCWGLFG*LK 354 + F+ +EY W CW +G L+ Sbjct: 56 RPFRQDEYSWNDCWMRWGQLR 76 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,581,963 Number of Sequences: 5004 Number of extensions: 25860 Number of successful extensions: 52 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 52 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 200198394 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -