BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30659x (499 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g00950.1 68417.m00128 expressed protein 27 9.3 At2g36770.1 68415.m04510 UDP-glucoronosyl/UDP-glucosyl transfera... 27 9.3 >At4g00950.1 68417.m00128 expressed protein Length = 291 Score = 26.6 bits (56), Expect = 9.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -2 Query: 246 LQLKMIPTLIKC*SKSMSNAFHTDFGKSVPF 154 ++L ++PT S SMS+ H+ SVPF Sbjct: 16 MKLPVLPTKPNTHSHSMSSPIHSSISASVPF 46 >At2g36770.1 68415.m04510 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 496 Score = 26.6 bits (56), Expect = 9.3 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -1 Query: 208 IKINVKCISYRLWKVSPVLLCNKLSPSK 125 +K K + ++W + PV LCNK K Sbjct: 237 VKDYTKARAGKVWSIGPVSLCNKAGADK 264 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,728,784 Number of Sequences: 28952 Number of extensions: 130768 Number of successful extensions: 180 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 180 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 180 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 878448512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -