BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30657x (431 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 24 2.7 DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 23 4.6 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 23 4.6 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 23.8 bits (49), Expect = 2.7 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +3 Query: 180 EGPQEITRVLELFSNSEDLMDEVLNQIMLCL 272 E PQE R L+ +S+D M +NQ + L Sbjct: 958 EDPQEAGRKLKKLQDSKDKMSRNVNQKAMVL 988 >DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. Length = 407 Score = 23.0 bits (47), Expect = 4.6 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +3 Query: 141 GLLAPTTSWIVQFEGPQEITRVLELFSNSEDLMDEVLN 254 GLLAPTTS + E ++ V+ S + +DE+++ Sbjct: 2 GLLAPTTSCDGEEELQVQLRSVIITRSKAGATVDEIID 39 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 23.0 bits (47), Expect = 4.6 Identities = 7/28 (25%), Positives = 15/28 (53%) Frame = -1 Query: 218 EKFKYASNFLWPFKLNNPTGGWRKKTIH 135 E+F + ++ +P + G W K ++H Sbjct: 14 EQFHFLNDLKYPVLIRQHLGNWIKDSLH 41 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 441,522 Number of Sequences: 2352 Number of extensions: 8675 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 35717724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -