BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30655 (647 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z54236-4|CAA90984.1| 1274|Caenorhabditis elegans Hypothetical pr... 30 1.2 AF067220-1|AAK84500.1| 1014|Caenorhabditis elegans Hypothetical ... 28 5.0 >Z54236-4|CAA90984.1| 1274|Caenorhabditis elegans Hypothetical protein C27B7.4 protein. Length = 1274 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/44 (29%), Positives = 28/44 (63%) Frame = -2 Query: 592 DSIKENALSPEVAKLKKVEDTPAKVKVDMLNLNLVTKTRKHLKR 461 +++KE E ++++ E+ P + ++LN+ + T+T+K LKR Sbjct: 8 NTMKEEQEEEERDEIEEKEEKPDAQQQELLNIRIPTQTKKSLKR 51 >AF067220-1|AAK84500.1| 1014|Caenorhabditis elegans Hypothetical protein C33E10.6 protein. Length = 1014 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = -2 Query: 601 KNTDSIKENALSPEVAKLKKVEDTPAKVKVDMLNLN 494 KN+ I +N LS E++K+ V D P V + +L+L+ Sbjct: 811 KNSTIIVDNLLSVEMSKISIVFDKPIYVALSILDLS 846 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,634,839 Number of Sequences: 27780 Number of extensions: 124861 Number of successful extensions: 485 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 470 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 484 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1434198608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -