BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30655 (647 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g53440.1 68418.m06641 expressed protein 29 2.7 At4g16050.1 68417.m02435 expressed protein 28 4.7 >At5g53440.1 68418.m06641 expressed protein Length = 1181 Score = 29.1 bits (62), Expect = 2.7 Identities = 17/52 (32%), Positives = 25/52 (48%) Frame = -2 Query: 646 PKRDSSSSEKDPKRGKNTDSIKENALSPEVAKLKKVEDTPAKVKVDMLNLNL 491 P+R SSS + G +D I + A S EVA+L + + KV N+ Sbjct: 454 PERQLSSSVVQEENGNASDQITKGASSREVAELSGGSERGTRQKVSEKTANM 505 >At4g16050.1 68417.m02435 expressed protein Length = 666 Score = 28.3 bits (60), Expect = 4.7 Identities = 18/41 (43%), Positives = 27/41 (65%), Gaps = 1/41 (2%) Frame = -2 Query: 634 SSSSEKDPKRGKNTD-SIKENALSPEVAKLKKVEDTPAKVK 515 ++ E+D +R K +IKE AL E A++ KVE+T AK+K Sbjct: 611 AAEKEEDDERLKQRKLAIKELALKTE-ARMLKVENTLAKIK 650 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,964,109 Number of Sequences: 28952 Number of extensions: 108197 Number of successful extensions: 372 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 364 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 372 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1344285648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -