BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30654 (657 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y09952-1|CAA71083.1| 115|Anopheles gambiae histone H3 protein. 27 0.39 AY035716-1|AAK61362.1| 136|Anopheles gambiae histone 3A protein. 27 0.39 AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhi... 26 0.91 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 25 2.8 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 23 8.5 >Y09952-1|CAA71083.1| 115|Anopheles gambiae histone H3 protein. Length = 115 Score = 27.5 bits (58), Expect = 0.39 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 267 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 371 GG P RYRPG ++ + R + T L+ PF Sbjct: 32 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 66 >AY035716-1|AAK61362.1| 136|Anopheles gambiae histone 3A protein. Length = 136 Score = 27.5 bits (58), Expect = 0.39 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 267 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 371 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhibitor protein protein. Length = 335 Score = 26.2 bits (55), Expect = 0.91 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = -1 Query: 285 KATSSHLFSIHSTD-CSGMLNR-FCTTEVSSRIL 190 K TS+ L+ +H+ D CSG + C+TE+ +L Sbjct: 230 KCTSNGLYCVHNKDCCSGACYKSVCSTEIRVGVL 263 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 24.6 bits (51), Expect = 2.8 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -3 Query: 415 QIQQLHNHGHQIP**NGEHHSKH 347 Q QQ H H HQ G+HH++H Sbjct: 642 QQQQQHQH-HQAHQHQGQHHAQH 663 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 23.0 bits (47), Expect = 8.5 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 Query: 578 SKARTGPKKPQPDH 619 S RTGPK PDH Sbjct: 556 SMLRTGPKSLAPDH 569 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 749,026 Number of Sequences: 2352 Number of extensions: 15779 Number of successful extensions: 34 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65232180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -