BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30651 (599 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 25 0.37 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 24 1.1 AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein p... 24 1.1 AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein p... 24 1.1 AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 23 1.5 X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 22 3.4 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 22 4.6 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 22 4.6 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.0 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 21 6.0 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 25.4 bits (53), Expect = 0.37 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -2 Query: 283 KYWVQSCGPNSRRVNPLPARTLVW 212 +YW+Q PN++ + +PA W Sbjct: 273 RYWLQKGAPNNKLILGIPAYGRAW 296 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 23.8 bits (49), Expect = 1.1 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 466 SINASSTACS*ISCRPITEDEKNFKAYQYLIGARSI 573 S+N +T + + + +TE EK F +YL AR I Sbjct: 249 SLNCLNTGRTNFTNKQLTELEKEFHFNKYLTRARRI 284 >AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 23.8 bits (49), Expect = 1.1 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 466 SINASSTACS*ISCRPITEDEKNFKAYQYLIGARSI 573 S+N +T + + + +TE EK F +YL AR I Sbjct: 38 SLNCLNTGRTNFTNKQLTELEKEFHFNKYLTRARRI 73 >AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 23.8 bits (49), Expect = 1.1 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 466 SINASSTACS*ISCRPITEDEKNFKAYQYLIGARSI 573 S+N +T + + + +TE EK F +YL AR I Sbjct: 38 SLNCLNTGRTNFTNKQLTELEKEFHFNKYLTRARRI 73 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 23.4 bits (48), Expect = 1.5 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 476 PVQQPAPKSVADLSLKMKR 532 P Q P P+SV LSL ++R Sbjct: 218 PSQSPEPESVRPLSLVVRR 236 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 22.2 bits (45), Expect = 3.4 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +1 Query: 193 DAQLFGTILKYAPVEDSLFVN*GRRIEPSICPN 291 D Q GTI P + ++F+ G + S+CP+ Sbjct: 217 DNQCSGTIDWALPNKRTVFIRKGGTAKASMCPS 249 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 21.8 bits (44), Expect = 4.6 Identities = 8/33 (24%), Positives = 19/33 (57%) Frame = -2 Query: 442 TFFFIGLTLQHLFAFREQYETRSVFLYSLNIDL 344 T+F ++ H+FA E +++ L ++N+ + Sbjct: 189 TYFLGNMSFAHIFALVEYDIFKALVLQTINLQI 221 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 21.8 bits (44), Expect = 4.6 Identities = 8/33 (24%), Positives = 19/33 (57%) Frame = -2 Query: 442 TFFFIGLTLQHLFAFREQYETRSVFLYSLNIDL 344 T+F ++ H+FA E +++ L ++N+ + Sbjct: 189 TYFLGNMSFAHIFALVEYDIFKALVLQTINLQI 221 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 6.0 Identities = 6/15 (40%), Positives = 8/15 (53%) Frame = +3 Query: 51 HFHKDWQRFVKTWFN 95 H H DW TW++ Sbjct: 1030 HMHPDWTTKPSTWWS 1044 Score = 21.4 bits (43), Expect = 6.0 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = -2 Query: 310 IYSNSNRSGKYWVQSCGPNSRRVNPLP 230 ++ N+N S YW+ P + V +P Sbjct: 1615 VFYNANFSINYWISEGVPRRKIVMGMP 1641 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 21.4 bits (43), Expect = 6.0 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 143 SFLYSILLSAVSSSW 99 SF+ S+L S V+S W Sbjct: 102 SFMTSVLFSQVASRW 116 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,077 Number of Sequences: 336 Number of extensions: 2956 Number of successful extensions: 12 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15143945 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -