BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30649X (474 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0168 - 1874297-1874645,1874968-1875137,1875688-1875807,187... 29 2.5 05_01_0445 + 3547176-3547577,3548625-3549557,3550246-3550524,355... 28 4.4 >04_01_0168 - 1874297-1874645,1874968-1875137,1875688-1875807, 1876750-1876812 Length = 233 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -2 Query: 347 P*TRVNVTGASGNSMSRRTCLDSPTFNTATG 255 P T + T A S S + C DSPT +T++G Sbjct: 4 PTTSYSTTSAMERSNSTKRCSDSPTVSTSSG 34 >05_01_0445 + 3547176-3547577,3548625-3549557,3550246-3550524, 3550624-3550752,3550813-3550869 Length = 599 Score = 27.9 bits (59), Expect = 4.4 Identities = 27/77 (35%), Positives = 40/77 (51%), Gaps = 4/77 (5%) Frame = +2 Query: 152 NKLVI---RQALLGPDAKPDELNVIQVEAMSLQEAVKHQ-SQY*KLVNQGMYVWTLNSQM 319 NKL+I ++ LL DEL+ I V+ +S+Q K + S KLV G +N + Sbjct: 284 NKLLIDSYKEQLLQALKDDDELSQI-VQDISIQGRYKSRFSTMKKLVKDGRKPEEVNDIL 342 Query: 320 RLLHLLLFRVRGSTLNW 370 L +L R GS+L+W Sbjct: 343 ALRVILEPRCDGSSLDW 359 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,698,780 Number of Sequences: 37544 Number of extensions: 231806 Number of successful extensions: 520 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 512 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 520 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 967140324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -