BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30648 (714 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22238| Best HMM Match : CMAS (HMM E-Value=3.5e-15) 34 0.100 SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_10648| Best HMM Match : 7TM-7TMR_HD (HMM E-Value=3.4) 28 6.5 SB_36761| Best HMM Match : DUF1279 (HMM E-Value=0.23) 28 8.6 SB_32195| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 >SB_22238| Best HMM Match : CMAS (HMM E-Value=3.5e-15) Length = 1605 Score = 34.3 bits (75), Expect = 0.100 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +3 Query: 396 TYALGIYHLNLFIAFLTPKIDPAMDLDDDENGPAL--PTRLVKNLDHSLDDYQNS 554 TY LG YHL F+ P++ D GP + + +V N D SL+D Q + Sbjct: 1360 TYELGYYHLKFFLCNFVPELLSHSRTQDSFLGPMMIYTSGIVYNEDESLEDAQRN 1414 >SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6489 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = -1 Query: 663 VMKYITRIGQNTGILKASTKVQQKAIKVLLVTDSQNLNSGN 541 ++K +T Q+T ST VQ+K IK+ + D+ N + N Sbjct: 491 IIKAVTSTSQHTHSDVRSTSVQEKTIKIKVTFDANNESEKN 531 >SB_10648| Best HMM Match : 7TM-7TMR_HD (HMM E-Value=3.4) Length = 272 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/43 (27%), Positives = 21/43 (48%), Gaps = 5/43 (11%) Frame = +2 Query: 311 RKDTVGWKCVGHGCIYYP-HNY*TRMV----YCHICVGYLPFK 424 R + W C+ H + YP + Y ++ CHI + YL ++ Sbjct: 228 RVSVISWSCIRHIVVVYPSYRYRASVILSSCICHIVIVYLSYR 270 >SB_36761| Best HMM Match : DUF1279 (HMM E-Value=0.23) Length = 244 Score = 27.9 bits (59), Expect = 8.6 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +2 Query: 563 LSVTKSTLIAFCCTFVDAFNIPVFWPILVMYFITLFC 673 +++ S L+ C T V F IP+ +P + Y +FC Sbjct: 184 VNLAVSGLLTVCTTMVMTFYIPLIYPKSMDYLNQVFC 220 >SB_32195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = -1 Query: 339 THFQPTVSLREGSICLMYSDKPAIFVSN--LRQYSFS 235 T F PT + R S+ + + KP V N +R+Y+F+ Sbjct: 115 TRFNPTATARRSSLGSLSTHKPVFTVDNKAIRKYAFT 151 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,123,797 Number of Sequences: 59808 Number of extensions: 437884 Number of successful extensions: 923 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 859 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 923 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1889780269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -