BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30646X (395 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT029949-1|ABM92823.1| 310|Drosophila melanogaster IP17161p pro... 27 9.0 BT029942-1|ABM92816.1| 310|Drosophila melanogaster IP16861p pro... 27 9.0 >BT029949-1|ABM92823.1| 310|Drosophila melanogaster IP17161p protein. Length = 310 Score = 27.1 bits (57), Expect = 9.0 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +1 Query: 136 ENSEKENKITETPMEDENNEEPDWPHIPKFK-KHKGRLVSE*EN*CTGML 282 ++ + E+ E ED+ EE D PK++ KGR + + C+G L Sbjct: 72 KDKDDEDATGEDDNEDDEEEEEDIKSKPKYRHTAKGRTIHRLADLCSGRL 121 >BT029942-1|ABM92816.1| 310|Drosophila melanogaster IP16861p protein. Length = 310 Score = 27.1 bits (57), Expect = 9.0 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +1 Query: 136 ENSEKENKITETPMEDENNEEPDWPHIPKFK-KHKGRLVSE*EN*CTGML 282 ++ + E+ E ED+ EE D PK++ KGR + + C+G L Sbjct: 72 KDKDDEDATGEDDNEDDEEEEEDIKSKPKYRHTAKGRTIHRLADLCSGRL 121 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,874,188 Number of Sequences: 53049 Number of extensions: 261057 Number of successful extensions: 809 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 720 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 809 length of database: 24,988,368 effective HSP length: 77 effective length of database: 20,903,595 effective search space used: 1128794130 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -