BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30645 (621 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0039 - 12718972-12720699 31 0.74 06_01_0172 + 1362101-1363708 31 0.74 04_04_0578 + 26353830-26353929,26354030-26354277,26354539-26354931 31 0.74 05_03_0604 - 16132173-16132391,16132488-16132556,16132824-161328... 29 2.3 01_06_0837 - 32328191-32328369,32328682-32328731,32328844-323289... 29 2.3 03_06_0417 - 33782577-33782687,33782996-33783052,33783110-337832... 29 3.0 07_03_0481 - 18572206-18574314,18574591-18575185,18575304-185753... 28 5.2 11_06_0221 - 21387365-21387652,21387892-21389952,21390360-21390395 28 6.9 06_03_0013 - 15393830-15394060,15394238-15394672 27 9.1 >07_03_0039 - 12718972-12720699 Length = 575 Score = 31.1 bits (67), Expect = 0.74 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = -2 Query: 326 TIFPSVKNSGAFNFNLIGLGSIFPMTLLAFPQPPIITSYIGS-DSC-GPVVSA 174 ++ P+V F F LG +FP LL P P +ITS + S ++C GP+ A Sbjct: 130 SLLPAVAALAHFGFPWSRLGLLFPTVLLRLP-PDLITSRLASLEACLGPLPRA 181 >06_01_0172 + 1362101-1363708 Length = 535 Score = 31.1 bits (67), Expect = 0.74 Identities = 24/67 (35%), Positives = 31/67 (46%), Gaps = 2/67 (2%) Frame = +1 Query: 286 KLKAPEFLTEGNIVVFGFVGIAALSPLDARVKLFHSYPGL--IPNLSQFTTSESAQAGVP 459 KL L NI++ G VGI LDA +K+ PGL P++ +TT SA G Sbjct: 186 KLYITPNLVSCNILLKGLVGIG---DLDAALKVLDEMPGLGITPDVVTYTTVLSAYCGKG 242 Query: 460 QAPGKSK 480 G K Sbjct: 243 DIEGAQK 249 >04_04_0578 + 26353830-26353929,26354030-26354277,26354539-26354931 Length = 246 Score = 31.1 bits (67), Expect = 0.74 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +3 Query: 306 LNGGEYRGFWVRWDSGIISAGREGEAIPFISWSDPEP 416 L G +R WV W +I AG G F+ PEP Sbjct: 195 LVGWNWRHHWVYWLGPLIGAGMAGALYEFVMAEQPEP 231 >05_03_0604 - 16132173-16132391,16132488-16132556,16132824-16132898, 16132981-16133113,16133188-16133297,16133360-16133407, 16133657-16133983,16135006-16135233,16135360-16135689, 16135780-16136586 Length = 781 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 3/60 (5%) Frame = +3 Query: 282 VEIESPGILNGGEYRGFWVRWDSGIIS--AGREGEAIPFISWSDPEP-FPVYYVGVCTGW 452 V++ G+ ++ +W+ G+IS GR W DP+P V YVG+ + W Sbjct: 88 VDVAGIGLCCSSSFQSYWISIYDGLISIGQGRHPNNNILFQWLDPDPNRNVQYVGL-SSW 146 >01_06_0837 - 32328191-32328369,32328682-32328731,32328844-32328923, 32329193-32329345,32329505-32329654,32329877-32330000, 32330086-32330198,32330287-32330420,32330566-32331232 Length = 549 Score = 29.5 bits (63), Expect = 2.3 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Frame = +3 Query: 294 SPGILNGGEYRGF---WVRWDSGIISAGREGEAIPFISWSDPEPFPVYY 431 SP +L GG Y G W+R I+ G + P + + D P ++Y Sbjct: 211 SPVVLFGGSYGGMLAAWMRLKYPHIAVGALASSAPILQFEDVVPSTIFY 259 >03_06_0417 - 33782577-33782687,33782996-33783052,33783110-33783205, 33783252-33783284,33783543-33783599,33783968-33784060, 33784308-33784395,33784812-33784835,33784956-33785164 Length = 255 Score = 29.1 bits (62), Expect = 3.0 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Frame = +1 Query: 319 NIVVFGFVGIAALSPLDARVKLFHSY-PGLIPNLSQFTTSESAQAGVPQAPGKSKCHRL 492 N VVF V I ++ +++LF P N QF T E ++G+PQ + HR+ Sbjct: 36 NPVVFFDVTIGSIPAGRIKMELFADIVPKTAENFRQFCTGEHRKSGLPQGYKGCQFHRV 94 >07_03_0481 - 18572206-18574314,18574591-18575185,18575304-18575371, 18577344-18577458,18578179-18578333,18578673-18580621, 18580691-18581372,18581550-18581621,18582558-18583199, 18583301-18583402,18585011-18585100 Length = 2192 Score = 28.3 bits (60), Expect = 5.2 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +1 Query: 334 GFVGIAALSPLDA-RVKLFHSYPGLIPNLSQFTTSESAQAGVPQAPGKS 477 G +G+ S D+ +K S P L PNLS T++E + VP+ P S Sbjct: 1515 GKLGLPNFSLEDSIPLKHLKSVPDLFPNLSLGTSNEYLRNCVPELPNSS 1563 >11_06_0221 - 21387365-21387652,21387892-21389952,21390360-21390395 Length = 794 Score = 27.9 bits (59), Expect = 6.9 Identities = 18/40 (45%), Positives = 21/40 (52%), Gaps = 5/40 (12%) Frame = -3 Query: 403 DQDMNGIASPSRPAEIMPLS-QR----TQKPRYSPPLRIP 299 D+ + SP+ PA P S QR Q PRY PPLR P Sbjct: 324 DRAASPARSPASPARRGPQSPQRRVSPAQSPRYQPPLRKP 363 >06_03_0013 - 15393830-15394060,15394238-15394672 Length = 221 Score = 27.5 bits (58), Expect = 9.1 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = +1 Query: 421 QFTTSESAQAGVPQAPGKSK-CHRLHL*QLLVRSTPWLPWRLRRKRTPSVWRSRY 582 + T S A+A Q G SK R H + + W W +RTP+VW Y Sbjct: 135 KMTVSVGAEAEWLQREGSSKEWIRWHCVGTVAKRRAWAAWT---RRTPNVWNHDY 186 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,551,619 Number of Sequences: 37544 Number of extensions: 369382 Number of successful extensions: 1066 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1042 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1066 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1502076244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -