BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30645 (621 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. 26 1.1 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 23 5.9 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 23 5.9 >DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. Length = 595 Score = 25.8 bits (54), Expect = 1.1 Identities = 17/45 (37%), Positives = 21/45 (46%) Frame = -2 Query: 374 LASSGDNAAIPTNPKTTIFPSVKNSGAFNFNLIGLGSIFPMTLLA 240 LA+ NA KT IF V +GA + L+G G LLA Sbjct: 34 LAAKIANALSNQKSKTEIFSPVSIAGALSLLLLGSGGQTQQELLA 78 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 23.4 bits (48), Expect = 5.9 Identities = 15/59 (25%), Positives = 24/59 (40%) Frame = +1 Query: 58 TIMANVMDVATDDNLQYQFFPVSSGSVQFKVRAANDAHIALTTGPQESDPMYEVMIGGW 234 T A V TD+N+QY + + F V +ND I+ +++ P W Sbjct: 473 TFSARVGRGLTDENMQYMYRKAYRDKLSFSV--SNDQMISFAQFCKDTTPECNYTFWEW 529 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 23.4 bits (48), Expect = 5.9 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 545 RSLQGSQGVLRTSSCYRCSRWHFDFPGACGTP 450 R + GS G+ T + + + FPGA G P Sbjct: 459 RGVPGSPGLPATVAAIKGDKGEPGFPGAIGRP 490 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 606,354 Number of Sequences: 2352 Number of extensions: 13720 Number of successful extensions: 125 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 125 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60214320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -