BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30643 (489 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 23 2.0 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 23 2.0 AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 21 6.0 AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 21 7.9 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 22.6 bits (46), Expect = 2.0 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -2 Query: 242 DHDSSLHLHFLNDAGEDAATDRNVTSEGTLLVNVG 138 D+D + H+ L+D + AT+R G L VN G Sbjct: 275 DYDLTTHVMLLSDWMHEDATER---FPGRLAVNTG 306 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 22.6 bits (46), Expect = 2.0 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -2 Query: 242 DHDSSLHLHFLNDAGEDAATDRNVTSEGTLLVNVG 138 D+D + H+ L+D + AT+R G L VN G Sbjct: 275 DYDLTTHVMLLSDWMHEDATER---FPGRLAVNTG 306 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 21.0 bits (42), Expect = 6.0 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +1 Query: 286 ETAQEYVRAFVALLHGRGDW*YCNDRRMQTFVQN 387 E E+ +A +HG + N RR+ T QN Sbjct: 98 EAFNEFRTKILAQVHGTNNGTNKNMRRLSTTTQN 131 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 20.6 bits (41), Expect = 7.9 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +3 Query: 267 PNTIGSRNGTGICPCICRLASWTWRLVI 350 PN I NGTG+ RLA+ LV+ Sbjct: 161 PNNIILGNGTGVQLVPTRLANGDIALVL 188 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,747 Number of Sequences: 336 Number of extensions: 2166 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11420693 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -