BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30642 (760 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF164153-1|AAD47077.1| 131|Anopheles gambiae ribosomal protein ... 25 3.3 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 24 4.4 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 24 4.4 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 24 4.4 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 24 4.4 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 24 4.4 AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 24 4.4 AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding pr... 23 7.7 AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding pr... 23 7.7 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 23 7.7 >AF164153-1|AAD47077.1| 131|Anopheles gambiae ribosomal protein S17 protein. Length = 131 Score = 24.6 bits (51), Expect = 3.3 Identities = 8/31 (25%), Positives = 21/31 (67%) Frame = +3 Query: 627 VVVDLFFYRDPEESEKDEQQAKEQAVVPTKP 719 V+++ ++ R + + +++ +E A++PTKP Sbjct: 15 VIIEKYYTRLTMDFDTNKRIVEEVAIIPTKP 45 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 24.2 bits (50), Expect = 4.4 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 432 STHY*SFICQHSCDCFVQHRLPTKIWDIAIPCNTKS 539 S H I QHS QH P + IA P KS Sbjct: 48 SVHAAPAIYQHSAPAIYQHSAPAIVKTIAQPTIIKS 83 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 24.2 bits (50), Expect = 4.4 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 432 STHY*SFICQHSCDCFVQHRLPTKIWDIAIPCNTKS 539 S H I QHS QH P + IA P KS Sbjct: 48 SVHAAPAIYQHSAPAIYQHSAPAIVKTIAQPTIIKS 83 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 24.2 bits (50), Expect = 4.4 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 432 STHY*SFICQHSCDCFVQHRLPTKIWDIAIPCNTKS 539 S H I QHS QH P + IA P KS Sbjct: 48 SVHAAPAIYQHSAPAIYQHSAPAIVKTIAQPTIIKS 83 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 24.2 bits (50), Expect = 4.4 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 432 STHY*SFICQHSCDCFVQHRLPTKIWDIAIPCNTKS 539 S H I QHS QH P + IA P KS Sbjct: 48 SVHAAPAIYQHSAPAIYQHSAPAIVKTIAQPTIIKS 83 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 24.2 bits (50), Expect = 4.4 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 432 STHY*SFICQHSCDCFVQHRLPTKIWDIAIPCNTKS 539 S H I QHS QH P + IA P KS Sbjct: 48 SVHAAPAIYQHSAPAIYQHSAPAIVKTIAQPTIIKS 83 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 24.2 bits (50), Expect = 4.4 Identities = 24/76 (31%), Positives = 38/76 (50%), Gaps = 2/76 (2%) Frame = +2 Query: 17 VVTQISATMSGGLDVLALNEEDVTKMLAATTHLGAENVNFQMETYVYKRRADGTH--VIN 190 +VT+++ + G+D+LA +EDV + L E T +++RR DGT + Sbjct: 202 IVTEMAEVLITGIDMLA-KKEDVERGL----QRALERTAVAATTSLWERR-DGTQRARVR 255 Query: 191 LRRTWEKLVLAARAVV 238 L R L+L R VV Sbjct: 256 LPRRDTDLLLDKRIVV 271 >AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding protein AgamOBP34 protein. Length = 311 Score = 23.4 bits (48), Expect = 7.7 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +3 Query: 246 RTP*CVRHLITALRSACCTEVCRAHRC-YAYCGA 344 RT C+ + CT+V +A +C Y Y GA Sbjct: 119 RTEACLAENLYTCDDDLCTQVYKAFQCYYQYYGA 152 >AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding protein AgamOBP37 protein. Length = 311 Score = 23.4 bits (48), Expect = 7.7 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +3 Query: 246 RTP*CVRHLITALRSACCTEVCRAHRC-YAYCGA 344 RT C+ + CT+V +A +C Y Y GA Sbjct: 119 RTEACLAENLYTCDDDLCTQVYKAFQCYYQYYGA 152 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 23.4 bits (48), Expect = 7.7 Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = +3 Query: 606 PRDQRWDVVV---DLFFYRDPEESEKDEQQAKEQAVVP 710 P+ Q W VV +R P++ ++ +QQ E+ V P Sbjct: 230 PQQQLWTTVVRGRPSQRHRQPQQQQQQQQQQGERYVPP 267 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 886,803 Number of Sequences: 2352 Number of extensions: 20631 Number of successful extensions: 44 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -