BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30642 (760 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 25 0.58 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 25 0.58 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 24 1.8 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 5.4 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 5.4 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 22 7.2 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 7.2 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 7.2 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 7.2 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 7.2 AB264335-1|BAF44090.1| 87|Apis mellifera ecdysone-induced prot... 22 7.2 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 9.5 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 9.5 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 25.4 bits (53), Expect = 0.58 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -1 Query: 631 TTSQRWSRGSTPRSLNTSRANNHHIKP 551 T +Q WSRG+T SL+ S + + P Sbjct: 18 TQAQHWSRGNTWLSLDNSNMSMSSVGP 44 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 25.4 bits (53), Expect = 0.58 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -1 Query: 631 TTSQRWSRGSTPRSLNTSRANNHHIKP 551 T +Q WSRG+T SL+ S + + P Sbjct: 18 TQAQHWSRGNTWLSLDNSNMSMSSVGP 44 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -2 Query: 642 TNQPQHPSAGHGEAHHEASTLH 577 T P H + GHG +H A+ H Sbjct: 411 TPGPHHHTMGHGHSHIHATPHH 432 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +3 Query: 594 RGVLPRDQRWDVVVDLFFYRDPEESEKDEQQAK 692 R +LPR ++ + LF Y P SE ++ ++ Sbjct: 603 RLLLPRGKKEGMPFQLFLYVSPVSSEYNQYNSR 635 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +3 Query: 594 RGVLPRDQRWDVVVDLFFYRDPEESEKDEQQAK 692 R +LPR ++ + LF Y P SE ++ ++ Sbjct: 603 RLLLPRGKKEGMPFQLFLYVSPVSSEYNQYNSR 635 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.8 bits (44), Expect = 7.2 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -3 Query: 278 RDEMTNTSRGSRWLRQHEQ 222 +D+ N RG+++L H+Q Sbjct: 264 QDQQANIGRGAQYLYLHQQ 282 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +3 Query: 675 DEQQAKEQAVVPTKPEVVAPVHED 746 ++ + KE+ P + E VA +H+D Sbjct: 109 EQVRTKEEPHAPYRYEAVAVIHKD 132 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +3 Query: 675 DEQQAKEQAVVPTKPEVVAPVHED 746 ++ + KE+ P + E VA +H+D Sbjct: 109 EQVRTKEEPHAPYRYEAVAVIHKD 132 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +3 Query: 675 DEQQAKEQAVVPTKPEVVAPVHED 746 ++ + KE+ P + E VA +H+D Sbjct: 109 EQVRTKEEPHAPYRYEAVAVIHKD 132 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.8 bits (44), Expect = 7.2 Identities = 6/30 (20%), Positives = 16/30 (53%) Frame = +1 Query: 409 VLDPAQDHQPITEASYVNIPVIALCNTDSP 498 ++DP ++++ E + IP++ + P Sbjct: 167 IVDPVEENETYDEFDTIRIPIVRSLSKSPP 196 >AB264335-1|BAF44090.1| 87|Apis mellifera ecdysone-induced protein 75 protein. Length = 87 Score = 21.8 bits (44), Expect = 7.2 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = +1 Query: 181 CDQLASYLGKTCSGCSCCRSHREPRDVFVISSRPFGQRAV 300 CD G CS S S + + FV S+ F +R++ Sbjct: 7 CDLATPRTGTNCSSGSSSDSDGQTDEGFVGDSQGFFRRSI 46 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.4 bits (43), Expect = 9.5 Identities = 6/18 (33%), Positives = 13/18 (72%) Frame = +2 Query: 518 YPMQHQVFPLYWFDVVVV 571 +P ++++P Y+FD V+ Sbjct: 159 FPAIYEIYPNYFFDSSVI 176 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.4 bits (43), Expect = 9.5 Identities = 6/18 (33%), Positives = 13/18 (72%) Frame = +2 Query: 518 YPMQHQVFPLYWFDVVVV 571 +P ++++P Y+FD V+ Sbjct: 159 FPAIYEIYPNYFFDSSVI 176 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 226,959 Number of Sequences: 438 Number of extensions: 5328 Number of successful extensions: 17 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23875740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -