BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30641 (691 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55237| Best HMM Match : Serpin (HMM E-Value=0) 44 9e-05 SB_38975| Best HMM Match : Serpin (HMM E-Value=0) 41 0.001 SB_55238| Best HMM Match : Serpin (HMM E-Value=0) 40 0.002 SB_27848| Best HMM Match : zf-C2H2 (HMM E-Value=1.49995e-41) 29 3.6 SB_55414| Best HMM Match : 7tm_1 (HMM E-Value=4.3e-08) 29 4.7 SB_4415| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_27683| Best HMM Match : Exo_endo_phos (HMM E-Value=1.5e-20) 28 8.2 SB_24891| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_11238| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_48263| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_29987| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 >SB_55237| Best HMM Match : Serpin (HMM E-Value=0) Length = 363 Score = 44.4 bits (100), Expect = 9e-05 Identities = 20/61 (32%), Positives = 36/61 (59%), Gaps = 1/61 (1%) Frame = +2 Query: 509 IKDLVNPDSLSSATAAVLVNAIYFKGAWSSKFDERLTSDRDFYVSKTNNQSTH-DV*TRR 685 IK+L+ ++S T ++VNA+YFKG W +F E T F+V +++ ++ TR+ Sbjct: 113 IKELIPHGVINSLTRLIIVNAVYFKGVWKKEFGEENTFHAAFFVPESHESKIEVEMMTRK 172 Query: 686 L 688 + Sbjct: 173 M 173 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/54 (31%), Positives = 34/54 (62%), Gaps = 1/54 (1%) Frame = +3 Query: 336 ELKMANKVYVHDGGKLDENFAVVSRDVFNSDVQNIDF-SKNTVAAKSINDWVEE 494 E+++ NK++ HD ++ E F +R+ ++S++ +DF +K A K +N WV + Sbjct: 54 EIQLVNKIWGHDEFEILEEFLHGTREFYHSEMAQVDFVNKAFDARKEVNAWVHQ 107 >SB_38975| Best HMM Match : Serpin (HMM E-Value=0) Length = 380 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/78 (25%), Positives = 45/78 (57%), Gaps = 1/78 (1%) Frame = +3 Query: 264 FPDDDAIRTEFASKSRDLRSIKGVELKMANKVYVHDGGKLDENFAVVSRDVFNSDVQNID 443 FP D + ++ + + G ++ MAN+++ G ++ E F S++ F++++ +D Sbjct: 62 FPTDVPEKFHDFLQALNASNSDGNQILMANRLFAQMGFEILEEFKKASKESFSAEMALVD 121 Query: 444 FSKNTVAAK-SINDWVEE 494 + KN+ A+ ++N WVE+ Sbjct: 122 YVKNSNGARDTVNRWVEQ 139 Score = 37.1 bits (82), Expect = 0.013 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +2 Query: 509 IKDLVNPDSLSSATAAVLVNAIYFKGAWSSKFDERLTSDRDF 634 IK+L+ + T LVNA+YFKG+W F+ T F Sbjct: 145 IKNLIPEGMFNKDTILCLVNAVYFKGSWMKHFNRNATQSGKF 186 >SB_55238| Best HMM Match : Serpin (HMM E-Value=0) Length = 345 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/48 (37%), Positives = 25/48 (52%) Frame = +2 Query: 509 IKDLVNPDSLSSATAAVLVNAIYFKGAWSSKFDERLTSDRDFYVSKTN 652 I DL+ P + T LVNAIYFKG W F + + +F + +N Sbjct: 108 ICDLIAPGVFNMLTRLTLVNAIYFKGMWDKPFKKEHSHSSEFRTTSSN 155 Score = 32.7 bits (71), Expect = 0.29 Identities = 13/54 (24%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +3 Query: 336 ELKMANKVYVHDGGKLDENFAVVSRDVFNSDVQNIDFSKNTVAA-KSINDWVEE 494 E+ +AN +++ + + F + + +++D+ +D+ + A K +N WVEE Sbjct: 49 EMSIANNLFLQKDFSILKEFTDICQKYYDADISLVDYKTDFEGARKHVNQWVEE 102 >SB_27848| Best HMM Match : zf-C2H2 (HMM E-Value=1.49995e-41) Length = 257 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 388 RILQSFPGTSSIRTSKTLISRRIQSQLS 471 R+ SFPG S TL++R QSQ+S Sbjct: 65 RLYDSFPGASRSEAESTLLARMRQSQVS 92 >SB_55414| Best HMM Match : 7tm_1 (HMM E-Value=4.3e-08) Length = 595 Score = 28.7 bits (61), Expect = 4.7 Identities = 17/56 (30%), Positives = 31/56 (55%) Frame = +1 Query: 64 AMAAVTNLSNVLKNGNDNFTARMFTEVVKNNPGKSVVLSAFSVLPPLAQLALASDG 231 +MAAV + +L+ + + + ++KNN +S+ AF+ L L L L+S+G Sbjct: 36 SMAAVCRPAGLLEPDHFALPVAVESLILKNNSIRSIAKGAFNGLDKLLTLDLSSNG 91 >SB_4415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 640 Score = 28.7 bits (61), Expect = 4.7 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -2 Query: 72 CHCRDGDSKQTNDCL 28 CHCRDG+S Q N+ + Sbjct: 336 CHCRDGESVQVNNAM 350 >SB_27683| Best HMM Match : Exo_endo_phos (HMM E-Value=1.5e-20) Length = 672 Score = 27.9 bits (59), Expect = 8.2 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -1 Query: 229 HQKLKLTEREEAAPKMPRGQRFSL 158 HQ L + E + ++PK PR +F L Sbjct: 56 HQNLSINEMDSSSPKRPRQHQFGL 79 >SB_24891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 345 Score = 27.9 bits (59), Expect = 8.2 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -1 Query: 229 HQKLKLTEREEAAPKMPRGQRFSL 158 HQ L + E + ++PK PR +F L Sbjct: 21 HQNLSINEMDSSSPKRPRQHQFGL 44 >SB_11238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.9 bits (59), Expect = 8.2 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -1 Query: 229 HQKLKLTEREEAAPKMPRGQRFSL 158 HQ L + E + ++PK PR +F L Sbjct: 50 HQNLSINEMDSSSPKRPRQHQFGL 73 >SB_48263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.9 bits (59), Expect = 8.2 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -1 Query: 229 HQKLKLTEREEAAPKMPRGQRFSL 158 HQ L + E + ++PK PR +F L Sbjct: 21 HQNLSINEMDSSSPKRPRQHQFGL 44 >SB_29987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 27.9 bits (59), Expect = 8.2 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -1 Query: 229 HQKLKLTEREEAAPKMPRGQRFSL 158 HQ L + E + ++PK PR +F L Sbjct: 7 HQNLSINEMDSSSPKCPRQHQFGL 30 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,879,523 Number of Sequences: 59808 Number of extensions: 383660 Number of successful extensions: 1186 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1051 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1186 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1793485733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -