SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV30640
         (752 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292376-1|CAL23188.2|  402|Tribolium castaneum gustatory recept...    23   2.0  
AY531877-1|AAT08872.1|  247|Tribolium castaneum ORF1p protein.         22   4.6  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    21   8.0  
AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.     21   8.0  

>AM292376-1|CAL23188.2|  402|Tribolium castaneum gustatory receptor
           candidate 55 protein.
          Length = 402

 Score = 23.4 bits (48), Expect = 2.0
 Identities = 17/72 (23%), Positives = 30/72 (41%)
 Frame = -1

Query: 524 TIPTMLCCLMAEPSWLQTVALLLYA*HQDCVQSQWRSFQRHVPDDLYLPFSLQDCTQWYP 345
           T+P ++C ++     +  + LL+YA    C Q+       H   + Y    L++  Q Y 
Sbjct: 285 TVPMIVCPIVWLMDEVVEIYLLVYACASTCEQANDTPSILHELRNNYFHMDLENNVQSYS 344

Query: 344 QA*LQQASHFQL 309
              L Q   F +
Sbjct: 345 LQLLHQKVQFSV 356


>AY531877-1|AAT08872.1|  247|Tribolium castaneum ORF1p protein.
          Length = 247

 Score = 22.2 bits (45), Expect = 4.6
 Identities = 14/37 (37%), Positives = 18/37 (48%)
 Frame = +2

Query: 311 VGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFA 421
           VG  +      EG     L E +GD G+L  AS +FA
Sbjct: 91  VGTALTFCLQEEGGTTSQLIELLGDAGKLL-ASVHFA 126


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 21.4 bits (43), Expect = 8.0
 Identities = 5/11 (45%), Positives = 7/11 (63%)
 Frame = +1

Query: 409  WKLRHCDWTQS 441
            W   HCDW ++
Sbjct: 2271 WNKDHCDWPEN 2281


>AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.
          Length = 697

 Score = 21.4 bits (43), Expect = 8.0
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -3

Query: 489 TFLAPDGSFTLVR 451
           T   PDG FT++R
Sbjct: 579 TVTVPDGGFTIIR 591


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 185,511
Number of Sequences: 336
Number of extensions: 4279
Number of successful extensions: 9
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 20131186
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -