BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30638 (529 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 1.9 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 23 2.6 AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 22 3.4 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 21 7.8 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.0 bits (47), Expect = 1.9 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = +1 Query: 220 GVYSNVRSSHLFSANFRISLIALGARFLNPTP*SRLCKL 336 G Y VR S R+++ A+ + +P P +C L Sbjct: 551 GKYEWVRVGKYLSGELRLNMSAIQFKLGHPEPPESVCSL 589 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 22.6 bits (46), Expect = 2.6 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +3 Query: 405 HCYLKFRVPNST*KSFVC 458 H YLKF P SF+C Sbjct: 104 HEYLKFSYPRMRAPSFIC 121 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 22.2 bits (45), Expect = 3.4 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 431 RYTKLKITMAKPKG 390 RY+KLK KPKG Sbjct: 26 RYSKLKRNWRKPKG 39 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.0 bits (42), Expect = 7.8 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 Query: 358 TSFMADLPFLSPLGLAIVILSFVYRIQLRKAL 453 T F A FLS L A+++ +RI R L Sbjct: 7 TGFSASSVFLSLLIPALILYFIYFRISRRHLL 38 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,546 Number of Sequences: 438 Number of extensions: 2801 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14845611 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -