BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30632 (749 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12681| Best HMM Match : LSM (HMM E-Value=5.7e-18) 106 2e-23 SB_2028| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26035| Best HMM Match : LSM (HMM E-Value=6.1e-13) 33 0.25 SB_526| Best HMM Match : GRP (HMM E-Value=8.5) 31 1.00 SB_18906| Best HMM Match : LSM (HMM E-Value=3.2e-15) 30 2.3 SB_25863| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_54435| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_51493| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.00067) 28 7.0 SB_50229| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_50276| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_7168| Best HMM Match : Death (HMM E-Value=1.9e-06) 28 9.3 >SB_12681| Best HMM Match : LSM (HMM E-Value=5.7e-18) Length = 327 Score = 106 bits (254), Expect = 2e-23 Identities = 48/67 (71%), Positives = 56/67 (83%) Frame = +1 Query: 58 KMTIGKNNKMQQHINYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEEFRKIKSKNSKTA 237 K TIGK++KM HINYR+R LQD R FIGTF AFDKHMN+ILGDC+EFRKIK K+SK Sbjct: 23 KPTIGKSSKMLLHINYRMRCTLQDGRVFIGTFLAFDKHMNVILGDCDEFRKIKGKSSKAQ 82 Query: 238 DREEKRL 258 +REEKR+ Sbjct: 83 EREEKRV 89 Score = 31.1 bits (67), Expect = 1.00 Identities = 12/22 (54%), Positives = 18/22 (81%) Frame = +3 Query: 240 QRRKKTLGFVLLRGENIVSLTI 305 + K+ LG VLLRGE++VS+T+ Sbjct: 84 REEKRVLGLVLLRGEHLVSMTV 105 >SB_2028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 681 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/44 (40%), Positives = 28/44 (63%) Frame = +1 Query: 73 KNNKMQQHINYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEEF 204 + +++ +N +RV + D RT IG+F DK N+ILG C+EF Sbjct: 29 QRKELESWLNKLMRVKISDGRTLIGSFLCTDKDRNIILGSCQEF 72 >SB_26035| Best HMM Match : LSM (HMM E-Value=6.1e-13) Length = 75 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +1 Query: 97 INYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEE 201 ++ R+ V +++ R G A+D+H+N+IL D EE Sbjct: 24 LDERIYVKMRNDRELRGRLHAYDQHLNMILSDVEE 58 >SB_526| Best HMM Match : GRP (HMM E-Value=8.5) Length = 149 Score = 31.1 bits (67), Expect = 1.00 Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = +1 Query: 526 HDGWPSSRNDGSSSWHGSWWAKT-GSSRNAT 615 +DGW ++ DG ++ +G W T G+ RNAT Sbjct: 85 YDGWNATNGDGWNATNGDGWNGTNGNGRNAT 115 >SB_18906| Best HMM Match : LSM (HMM E-Value=3.2e-15) Length = 443 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/44 (29%), Positives = 25/44 (56%) Frame = +1 Query: 100 NYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEEFRKIKSKNSK 231 N +V + +++R + KAFD+H N++L + +E K+ K Sbjct: 29 NTQVLINCRNNRKLLARVKAFDRHCNMVLENVKEMWTETPKSGK 72 >SB_25863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 813 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = +1 Query: 37 YLPNHSDKMTIGKNNKMQQHINY--RVRVILQDSR 135 ++P H+ M IGK +M + I + RVR I+ SR Sbjct: 334 FIPEHAMGMVIGKKGRMLEEIKHKTRVRPIIDKSR 368 >SB_54435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 28.7 bits (61), Expect = 5.3 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +2 Query: 197 KNSEKLNLKIVKLQTEKKK 253 K KLN+K+ KL+TEKKK Sbjct: 34 KEVRKLNIKVEKLKTEKKK 52 >SB_51493| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.00067) Length = 1873 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 538 PSSRNDGSSSWHGSWWAKTGSSRNATLL 621 PSS SS+W G+ K + RNAT L Sbjct: 1785 PSSPTSASSNWAGTGVPKPSTRRNATFL 1812 >SB_50229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1719 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 538 PSSRNDGSSSWHGSWWAKTGSSRNATLL 621 PSS SS+W G+ K + RNAT L Sbjct: 1571 PSSPTSASSNWAGTGVPKPSTRRNATFL 1598 >SB_50276| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1048 Score = 27.9 bits (59), Expect = 9.3 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -3 Query: 741 QHVHHSTNFMFIHKIRGYSQLLIQHCF 661 QH+H S N+ F H I+ + + + F Sbjct: 195 QHLHKSKNWYFAHNIKSFKNTFVYNTF 221 >SB_7168| Best HMM Match : Death (HMM E-Value=1.9e-06) Length = 206 Score = 27.9 bits (59), Expect = 9.3 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -3 Query: 510 WEEQKVDH--DFLVPCVVEMARLLLWQDLEDPEVLRPGQCLYQQH 382 WEE+ D D LV + +M RL + QDL E + P + Q H Sbjct: 116 WEERGHDFGMDRLVCILRDMGRLDVVQDLGKKECIHPSELCSQHH 160 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,799,659 Number of Sequences: 59808 Number of extensions: 327973 Number of successful extensions: 640 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 640 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -