BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30627 (702 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 22 5.6 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 7.4 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 21.8 bits (44), Expect = 5.6 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = -2 Query: 503 LLSVIESHFNQVFHFDLSHVVHDELVVQQRAVLRPVDGRPER 378 +L +++ N + F LS +++L +A +RPV P+R Sbjct: 35 MLPYPQNYINS-YLFSLSLAQNNQLFTHHKAPIRPVALPPKR 75 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 7.4 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = -3 Query: 334 GSVRPTPHTECVPDGALEKP 275 G V P PHT G L P Sbjct: 74 GKVEPVPHTSSFNMGYLVSP 93 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,727 Number of Sequences: 336 Number of extensions: 3595 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18530690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -