BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30627 (702 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 24 4.0 AF515525-1|AAM61892.1| 235|Anopheles gambiae glutathione S-tran... 24 5.3 DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 23 7.0 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 9.3 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 9.3 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 24.2 bits (50), Expect = 4.0 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +2 Query: 50 GTAPAPPTSPALFHKVFVLRR-PKLQS 127 GTAP P T LF + V RR +LQS Sbjct: 51 GTAPEPVTEDDLFPEEMVKRRTSRLQS 77 >AF515525-1|AAM61892.1| 235|Anopheles gambiae glutathione S-transferase protein. Length = 235 Score = 23.8 bits (49), Expect = 5.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -2 Query: 92 CEIMPAKLVVREPCHKRRRLWSFL 21 CEI AK+ +PC R L S+L Sbjct: 177 CEIEQAKIAGYDPCEGRPALASWL 200 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 23.4 bits (48), Expect = 7.0 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 82 CRRSWWCGSRATRG 41 CRRS +CG + RG Sbjct: 235 CRRSCYCGCQCRRG 248 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.0 bits (47), Expect = 9.3 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = +2 Query: 11 TSPSRNSTTAASCGTAPAPPTSPALFHKVFVLRRPKLQSRATCSARAYT 157 T +R T + + +PP SP H+ + PK AR+YT Sbjct: 282 TRRTRTQTDCSEASSDGSPPRSPEGSHEEVEMDEPK--KILIVDARSYT 328 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.0 bits (47), Expect = 9.3 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = +2 Query: 11 TSPSRNSTTAASCGTAPAPPTSPALFHKVFVLRRPKLQSRATCSARAYT 157 T +R T + + +PP SP H+ + PK AR+YT Sbjct: 282 TRRTRTQTDCSEASSDGSPPRSPEGSHEEVEMDEPK--KILIVDARSYT 328 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 726,573 Number of Sequences: 2352 Number of extensions: 16745 Number of successful extensions: 26 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71504505 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -