BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30626 (698 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 22 4.2 EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 21 7.3 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 21 7.3 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 21 9.7 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 9.7 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 9.7 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 9.7 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 9.7 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 21 9.7 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 9.7 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 21 9.7 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 9.7 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 22.2 bits (45), Expect = 4.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = -1 Query: 341 SNSSLELGTEIFWFDVQNFRCKNS 270 S++ +E + ++WF V+ CK S Sbjct: 389 SDAEIEKLSTVYWFTVEFGLCKES 412 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 21.4 bits (43), Expect = 7.3 Identities = 11/30 (36%), Positives = 12/30 (40%), Gaps = 8/30 (26%) Frame = +2 Query: 368 WLPNYC-----FSPAF---HCQWFQEPFGH 433 W NYC +P HC W FGH Sbjct: 79 WRSNYCDNKQQANPPISTEHCDWLYGIFGH 108 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 21.4 bits (43), Expect = 7.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -3 Query: 39 QWGNGTRTSW 10 Q+GNG TSW Sbjct: 274 QFGNGLETSW 283 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 343 LATPAWNLARRSSGLMSRIS 284 L+TP+ + A +SSGL S +S Sbjct: 129 LSTPSNSNATKSSGLTSPLS 148 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 343 LATPAWNLARRSSGLMSRIS 284 L+TP+ + A +SSGL S +S Sbjct: 129 LSTPSNSNATKSSGLTSPLS 148 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 343 LATPAWNLARRSSGLMSRIS 284 L+TP+ + A +SSGL S +S Sbjct: 129 LSTPSNSNATKSSGLTSPLS 148 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 343 LATPAWNLARRSSGLMSRIS 284 L+TP+ + A +SSGL S +S Sbjct: 129 LSTPSNSNATKSSGLTSPLS 148 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 343 LATPAWNLARRSSGLMSRIS 284 L+TP+ + A +SSGL S +S Sbjct: 129 LSTPSNSNATKSSGLTSPLS 148 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 343 LATPAWNLARRSSGLMSRIS 284 L+TP+ + A +SSGL S +S Sbjct: 85 LSTPSNSNATKSSGLTSPLS 104 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 343 LATPAWNLARRSSGLMSRIS 284 L+TP+ + A +SSGL S +S Sbjct: 129 LSTPSNSNATKSSGLTSPLS 148 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 343 LATPAWNLARRSSGLMSRIS 284 L+TP+ + A +SSGL S +S Sbjct: 129 LSTPSNSNATKSSGLTSPLS 148 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 343 LATPAWNLARRSSGLMSRIS 284 L+TP+ + A +SSGL S +S Sbjct: 129 LSTPSNSNATKSSGLTSPLS 148 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,942 Number of Sequences: 336 Number of extensions: 2886 Number of successful extensions: 13 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -