BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30626 (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 24 1.6 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 22 6.4 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 6.4 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 8.5 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 23.8 bits (49), Expect = 1.6 Identities = 11/41 (26%), Positives = 18/41 (43%) Frame = -1 Query: 161 MCTSLMISIVPFEILVGIERAWKKEVFSGPRPVLWAGMTTD 39 +C ++ + + L WK GP+PV + G T D Sbjct: 8 LCGIAVLFLALYYYLTSTFDFWKSRGVVGPKPVPFFGTTKD 48 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.8 bits (44), Expect = 6.4 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -1 Query: 413 TIGNGMRG*SNSWVTNSQRKSSYISNSSLELGTEIF 306 T+ NG+ G + S VTN+ S +S+ + TE F Sbjct: 251 TVKNGIYGIALSPVTNNLYYSPLLSHGLYYVDTEQF 286 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 90 FLPGSFYPYQDFKGYY*NHQ 149 FLP S++P+Q Y H+ Sbjct: 311 FLPPSYHPHQHHPSQYHPHR 330 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = -3 Query: 174 TGLQDVYIVDDFN 136 TG+ D+++ DD N Sbjct: 114 TGISDLFVFDDLN 126 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,122 Number of Sequences: 438 Number of extensions: 3147 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -