BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30621 (612 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6677| Best HMM Match : Ribosomal_L1 (HMM E-Value=0.4) 84 7e-17 SB_42576| Best HMM Match : VlpA_repeat (HMM E-Value=8.1) 30 1.3 SB_45986| Best HMM Match : Extensin_2 (HMM E-Value=0.12) 28 6.9 SB_52977| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_30503| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 >SB_6677| Best HMM Match : Ribosomal_L1 (HMM E-Value=0.4) Length = 81 Score = 84.2 bits (199), Expect = 7e-17 Identities = 37/54 (68%), Positives = 47/54 (87%) Frame = +2 Query: 356 SESLIKQIPRLLGPGLNKAGKFPGLLSHQESMTQKIDEVKGTIKFQMKKVLVFL 517 S+SLIKQIPR+LGPGLNKAGKFP ++H E+M QKI++V+ TIKFQMKK+ + L Sbjct: 28 SDSLIKQIPRILGPGLNKAGKFPTPINHNENMVQKIEDVRSTIKFQMKKIFLAL 81 >SB_42576| Best HMM Match : VlpA_repeat (HMM E-Value=8.1) Length = 325 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +2 Query: 374 QIPRLLGPGLNKAGKFPGLLS--HQESMTQKIDEVKGTIKFQMKKV 505 +IP P +K K+PG ++ HQ + E GTI MK + Sbjct: 30 EIPGYYQPCTSKTSKYPGTMNLVHQRHRNTRTSEYPGTINLVMKDI 75 >SB_45986| Best HMM Match : Extensin_2 (HMM E-Value=0.12) Length = 1243 Score = 27.9 bits (59), Expect = 6.9 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 4/45 (8%) Frame = +3 Query: 120 LQIGLKNYDPQKDKRFSGTVKLKYIPRPKM-QVC---VLGDQQHC 242 LQ G K YDP K+K K KY+ PK+ + C ++ +QHC Sbjct: 336 LQCGKKFYDPLKEK----CAKNKYVYNPKIYKYCYGRIIPVKQHC 376 >SB_52977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 929 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 373 ADSPFVGSRFEQSW*IPWSSLPPGVHDAED 462 +DSP+ G+ + W I S+ P VHD D Sbjct: 725 SDSPYSGNSSGEDWDIYSSAQPTAVHDLPD 754 >SB_30503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1402 Score = 27.9 bits (59), Expect = 6.9 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 4/45 (8%) Frame = +3 Query: 120 LQIGLKNYDPQKDKRFSGTVKLKYIPRPKM-QVC---VLGDQQHC 242 LQ G K YDP K+K K KY+ PK+ + C ++ +QHC Sbjct: 336 LQCGKKFYDPLKEK----CAKNKYVYNPKIYKYCYGRIIPVKQHC 376 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,240,169 Number of Sequences: 59808 Number of extensions: 389676 Number of successful extensions: 896 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 869 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 896 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1499981500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -