BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30616 (298 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g24600.1 68416.m03090 hypothetical protein 28 1.3 At3g02220.1 68416.m00203 expressed protein 25 6.9 >At3g24600.1 68416.m03090 hypothetical protein Length = 506 Score = 27.9 bits (59), Expect = 1.3 Identities = 13/30 (43%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +2 Query: 167 IFFGQCSEICGANHSFIPIV-IESISIKNF 253 +F CS + GA+H F PIV ++S+ I +F Sbjct: 327 VFSVFCSVLWGASHPFSPIVSVKSVDIHSF 356 Score = 26.6 bits (56), Expect = 3.0 Identities = 13/30 (43%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = +2 Query: 167 IFFGQCSEICGANHSFIPIV-IESISIKNF 253 IFF CS + GA+ S PIV I+ +++++F Sbjct: 122 IFFLLCSVLFGASQSSPPIVYIKGVNVRSF 151 >At3g02220.1 68416.m00203 expressed protein Length = 227 Score = 25.4 bits (53), Expect = 6.9 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -1 Query: 226 YNRYKTMISSTNF*TLTKKNSRSINKEVC 140 Y +YKT+ +T TK+N R ++C Sbjct: 56 YGKYKTLTEATKCQKCTKRNVRQAYHKLC 84 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,753,508 Number of Sequences: 28952 Number of extensions: 74940 Number of successful extensions: 98 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 98 length of database: 12,070,560 effective HSP length: 70 effective length of database: 10,043,920 effective search space used: 281229760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -