BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30613 (576 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 2.5 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 21 5.7 DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 prot... 21 5.7 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 9.9 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 22.6 bits (46), Expect = 2.5 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 234 AGPFPASLCRKMGV 275 AGP P S+ KMG+ Sbjct: 101 AGPIPVSMASKMGL 114 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 21.4 bits (43), Expect = 5.7 Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -1 Query: 342 SMCMSCGVQVH-RGGTCP*QCSMVRPFYGISW 250 SM + VQ GG + ++ PFYG SW Sbjct: 222 SMSVDSSVQSWLSGGASASKVTLSVPFYGHSW 253 >DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 protein. Length = 383 Score = 21.4 bits (43), Expect = 5.7 Identities = 11/43 (25%), Positives = 22/43 (51%) Frame = +3 Query: 369 DRASFSKVVEAIKTNFNERYEELRKHWGGGVLGNKSNARIAKL 497 D+ +F ++ +K+ N + + L GG+ K + IAK+ Sbjct: 154 DKVNFVTLLGELKSALNAKGKTLSAAVSGGIASCKLSYDIAKV 196 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 20.6 bits (41), Expect = 9.9 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -3 Query: 166 CVCAGSDG 143 CVCAGS G Sbjct: 920 CVCAGSTG 927 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,947 Number of Sequences: 336 Number of extensions: 2044 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14308417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -