BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30608 (737 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 155 4e-38 SB_41378| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_15708| Best HMM Match : UQ_con (HMM E-Value=0) 59 4e-09 SB_44322| Best HMM Match : UQ_con (HMM E-Value=1.6e-37) 56 2e-08 SB_5638| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_26077| Best HMM Match : UQ_con (HMM E-Value=6e-18) 45 7e-05 SB_28812| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_28696| Best HMM Match : UQ_con (HMM E-Value=5.3e-30) 43 2e-04 SB_26076| Best HMM Match : UQ_con (HMM E-Value=3.6e-15) 42 4e-04 SB_26761| Best HMM Match : UQ_con (HMM E-Value=1.7e-06) 40 0.002 SB_3717| Best HMM Match : UQ_con (HMM E-Value=0.00017) 38 0.011 SB_21041| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.026 SB_33408| Best HMM Match : UQ_con (HMM E-Value=3.7e-07) 34 0.10 SB_7202| Best HMM Match : UQ_con (HMM E-Value=5.9e-05) 33 0.24 SB_33407| Best HMM Match : UQ_con (HMM E-Value=0) 33 0.24 SB_40772| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.97 SB_25516| Best HMM Match : AAA_2 (HMM E-Value=0) 31 0.97 SB_30411| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_26178| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_39170| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_35256| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_39603| Best HMM Match : HATPase_c (HMM E-Value=0.0009) 29 3.9 SB_36444| Best HMM Match : UQ_con (HMM E-Value=2.8) 28 6.9 SB_14337| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_1534| Best HMM Match : zf-FPG_IleRS (HMM E-Value=6.2) 28 9.1 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 155 bits (376), Expect = 4e-38 Identities = 63/75 (84%), Positives = 70/75 (93%) Frame = +3 Query: 513 TLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELP 692 TLY GGYFKAHM FP DYPYSPP+ RFLTK+WHPN+YE+GD+CISILHPPVDDPQSGELP Sbjct: 1167 TLYAGGYFKAHMSFPHDYPYSPPTFRFLTKMWHPNIYESGDVCISILHPPVDDPQSGELP 1226 Query: 693 CERWNPTQSVRTVLL 737 ERWNPTQ+VRT+LL Sbjct: 1227 SERWNPTQNVRTILL 1241 Score = 62.5 bits (145), Expect = 3e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = +1 Query: 382 SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGP 507 SSA+RAL LE K L EEPVEGF V++ E N FEW+VAIFGP Sbjct: 1123 SSAVRALQLELKKLTEEPVEGFTVEVPDESNTFEWDVAIFGP 1164 >SB_41378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 97.5 bits (232), Expect = 1e-20 Identities = 38/75 (50%), Positives = 53/75 (70%) Frame = +3 Query: 513 TLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELP 692 T Y+ GYFKA M FP +YP PP++ F++ +WHPNV++NG++CISILH P +D E Sbjct: 375 TYYEEGYFKASMVFPKEYPQRPPTLTFISDIWHPNVHKNGEVCISILHEPGEDKYGYEKA 434 Query: 693 CERWNPTQSVRTVLL 737 ERW P +V T++L Sbjct: 435 DERWRPIHTVETIML 449 Score = 38.3 bits (85), Expect = 0.006 Identities = 13/29 (44%), Positives = 22/29 (75%) Frame = +1 Query: 421 LQEEPVEGFRVKLLGEDNLFEWEVAIFGP 507 LQ++PVEGF L +++L++WE+ + GP Sbjct: 344 LQKKPVEGFSAGLFDDEDLYKWEIMVVGP 372 >SB_15708| Best HMM Match : UQ_con (HMM E-Value=0) Length = 145 Score = 58.8 bits (136), Expect = 4e-09 Identities = 21/47 (44%), Positives = 31/47 (65%) Frame = +3 Query: 519 YQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCISILHP 659 Y G F+ + FP +YP+ PP I F TK++HPN+ E G +C+ I+ P Sbjct: 37 YNKGAFRIEICFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPIISP 83 >SB_44322| Best HMM Match : UQ_con (HMM E-Value=1.6e-37) Length = 190 Score = 56.4 bits (130), Expect = 2e-08 Identities = 25/74 (33%), Positives = 39/74 (52%) Frame = +3 Query: 513 TLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELP 692 T Y G FK ++ P YP+ PP +RF+T ++HPN+ +G +C+ L P P Sbjct: 8 TPYHKGIFKLDIQIPERYPFEPPKVRFVTPIYHPNIDSSGRICLDTLKMP---------P 58 Query: 693 CERWNPTQSVRTVL 734 W P ++ +VL Sbjct: 59 KGMWKPALNISSVL 72 >SB_5638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 53.2 bits (122), Expect = 2e-07 Identities = 22/53 (41%), Positives = 35/53 (66%), Gaps = 5/53 (9%) Frame = +3 Query: 510 DTLYQGGYFKAHMKFPPDYPYSPPSIRFLTK-----VWHPNVYENGDLCISIL 653 DT Y+GG+F ++ PPDYP PP ++ +T ++PN+Y NG +C+SI+ Sbjct: 22 DTPYEGGFFYFLIRCPPDYPIRPPRVKLMTTGSGQVRFNPNLYRNGKVCLSII 74 >SB_26077| Best HMM Match : UQ_con (HMM E-Value=6e-18) Length = 215 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/49 (40%), Positives = 32/49 (65%), Gaps = 1/49 (2%) Frame = +3 Query: 510 DTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNV-YENGDLCISIL 653 D Y+GG FK +K DYP +PP R + ++HPN+ ++G +C+S+L Sbjct: 47 DGAYRGGQFKFSVK-TEDYPNTPPVPRCVNNIYHPNMDLDDGSVCLSLL 94 >SB_28812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 385 Score = 43.2 bits (97), Expect = 2e-04 Identities = 26/76 (34%), Positives = 36/76 (47%) Frame = +3 Query: 510 DTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGEL 689 DT + GG + + PP+YP PPSI LT + + L +S HP Sbjct: 50 DTEFAGGRYHGRIILPPEYPMKPPSIMLLTPNGRFEIGKKICLSMSAHHP---------- 99 Query: 690 PCERWNPTQSVRTVLL 737 E W P+ S+RTVL+ Sbjct: 100 --ETWQPSWSIRTVLM 113 Score = 28.7 bits (61), Expect = 5.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +1 Query: 382 SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGP 507 S A++ L E K L+ E + + L EDNLFEW + GP Sbjct: 9 SPAVKRLMREAKELRNA-TELYHAQPL-EDNLFEWHFTVRGP 48 >SB_28696| Best HMM Match : UQ_con (HMM E-Value=5.3e-30) Length = 204 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/62 (30%), Positives = 31/62 (50%) Frame = +3 Query: 549 KFPPDYPYSPPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQSVRT 728 K P+ PP +RF+T ++HPN+ +G +C+ L P P W P ++ + Sbjct: 34 KLEASTPFEPPKVRFVTPIYHPNIDSSGRICLDTLKMP---------PKGMWKPALNISS 84 Query: 729 VL 734 VL Sbjct: 85 VL 86 >SB_26076| Best HMM Match : UQ_con (HMM E-Value=3.6e-15) Length = 243 Score = 42.3 bits (95), Expect = 4e-04 Identities = 20/48 (41%), Positives = 29/48 (60%) Frame = +3 Query: 510 DTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGDLCISIL 653 D Y+GG FK ++ DYP PSI TK++HPN+ +C+S+L Sbjct: 47 DGAYRGGQFKFSVR-TTDYPNVAPSINCKTKIYHPNMDGYDGVCMSLL 93 >SB_26761| Best HMM Match : UQ_con (HMM E-Value=1.7e-06) Length = 739 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 3/50 (6%) Frame = +3 Query: 507 ADTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKV---WHPNVYENGDLCIS 647 A T Y G F + P +YP +PPS +L+ +PN+YE+G +CI+ Sbjct: 644 AGTPYDHGLFAFDILLPANYPDAPPSFHYLSMCNGRLNPNLYEDGKVCIT 693 >SB_3717| Best HMM Match : UQ_con (HMM E-Value=0.00017) Length = 123 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 510 DTLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVW 608 DT + GG + + PP+YP PPSI LT VW Sbjct: 15 DTEFAGGRYHGRIILPPEYPMKPPSIMLLT-VW 46 >SB_21041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 36.3 bits (80), Expect = 0.026 Identities = 12/21 (57%), Positives = 19/21 (90%) Frame = +3 Query: 591 FLTKVWHPNVYENGDLCISIL 653 FLTK++HPNV +NG++C++ L Sbjct: 147 FLTKIFHPNVAKNGEICVNTL 167 >SB_33408| Best HMM Match : UQ_con (HMM E-Value=3.7e-07) Length = 181 Score = 34.3 bits (75), Expect = 0.10 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 513 TLYQGGYFKAHMKFPPDYPYSPPSI 587 ++Y+GG F + FP DYP+ PP + Sbjct: 64 SVYEGGVFFLDIHFPTDYPFKPPKV 88 >SB_7202| Best HMM Match : UQ_con (HMM E-Value=5.9e-05) Length = 200 Score = 33.1 bits (72), Expect = 0.24 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 513 TLYQGGYFKAHMKFPPDYPYSPP 581 ++Y+GG F + FP DYP+ PP Sbjct: 177 SVYEGGVFFLDIHFPSDYPFKPP 199 >SB_33407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 226 Score = 33.1 bits (72), Expect = 0.24 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 513 TLYQGGYFKAHMKFPPDYPYSPP 581 ++Y+GG F + FP DYP+ PP Sbjct: 137 SVYEGGVFFLDIHFPSDYPFKPP 159 >SB_40772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 31.1 bits (67), Expect = 0.97 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +3 Query: 564 YPYSPPSIRFLTKVWHPNVYENG 632 +P S P ++F + V+HP ++ENG Sbjct: 118 FPDSRPLVKFTSNVFHPQIHENG 140 >SB_25516| Best HMM Match : AAA_2 (HMM E-Value=0) Length = 609 Score = 31.1 bits (67), Expect = 0.97 Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = +1 Query: 508 RIHFIKVD-TSRHT*NSPLTTRIHHHPLG 591 +IH I VD T RH SPL+ ++ HHP G Sbjct: 40 QIHAIAVDGTRRHANASPLSCQLLHHPTG 68 >SB_30411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 710 Score = 30.3 bits (65), Expect = 1.7 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +3 Query: 513 TLYQGGYFKAHMKFPPDYPYSPPSIRFLT 599 T Y+GG +K + P YP+ PSI T Sbjct: 60 TPYEGGVWKVRVDLPEKYPFKSPSIANFT 88 >SB_26178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 897 Score = 30.3 bits (65), Expect = 1.7 Identities = 12/40 (30%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +3 Query: 543 HMKFPPDYPYSPPSIRFLT-KVWHPNVYENGDLCISILHP 659 ++ FP ++P++PP +R L ++ V + G +C+ +L P Sbjct: 794 NITFPENFPFAPPFMRVLAPRIEGGFVLDGGAICMELLTP 833 >SB_39170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 29.5 bits (63), Expect = 3.0 Identities = 10/41 (24%), Positives = 23/41 (56%) Frame = +3 Query: 513 TLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGD 635 T+++ + + P+YP PP+++F++K+ V G+ Sbjct: 1 TVFENRIYNLKIVCGPNYPQKPPTVKFVSKINMNGVNSKGE 41 >SB_35256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 29.5 bits (63), Expect = 3.0 Identities = 10/41 (24%), Positives = 23/41 (56%) Frame = +3 Query: 513 TLYQGGYFKAHMKFPPDYPYSPPSIRFLTKVWHPNVYENGD 635 T+++ + + P+YP PP+++F++K+ V G+ Sbjct: 1 TVFENRIYNLKIVCGPNYPQKPPTVKFVSKINMNGVNSKGE 41 >SB_39603| Best HMM Match : HATPase_c (HMM E-Value=0.0009) Length = 888 Score = 29.1 bits (62), Expect = 3.9 Identities = 19/57 (33%), Positives = 24/57 (42%), Gaps = 2/57 (3%) Frame = +3 Query: 567 PYSPPSIRFLTKVWHPNVYENGDLCISILHP--PVDDPQSGELPCERWNPTQSVRTV 731 PY PPSI + HP +S P D Q + R PTQ+VRT+ Sbjct: 532 PYRPPSIDSAYRTDHPTQTVRSVQTLSSTDSAYPTDSTQHRQCAPYRLYPTQTVRTI 588 >SB_36444| Best HMM Match : UQ_con (HMM E-Value=2.8) Length = 55 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 510 DTLYQGGYFKAHMKFPPDYPYSPPSIRFLT 599 DT Y G F + FP YP PP ++ +T Sbjct: 17 DTPYSRGCFVFDIFFPGTYPNVPPLVKLIT 46 >SB_14337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 278 Score = 27.9 bits (59), Expect = 9.1 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 7/54 (12%) Frame = +3 Query: 570 YSPPSI-----RFLTKVWHP-NVYE-NGDLCISILHPPVDDPQSGELPCERWNP 710 ++PPS+ L K W+P ++++ G + +PP D G + ++WNP Sbjct: 176 WNPPSLDDIGGSILAKQWNPPSLHDIGGSILAQQWNPPSLDDNGGSILAKQWNP 229 >SB_1534| Best HMM Match : zf-FPG_IleRS (HMM E-Value=6.2) Length = 76 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -2 Query: 487 PTQIDCPLLAI*HGNLLQVLLADSCTPTLKP 395 P +D LAI H L + D C PT +P Sbjct: 3 PCDLDAAALAIRHALLTAATMCDRCWPTWRP 33 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,589,772 Number of Sequences: 59808 Number of extensions: 553023 Number of successful extensions: 1407 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 1239 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1402 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1986074805 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -