SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV30598
         (736 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292349-1|CAL23161.1|  248|Tribolium castaneum gustatory recept...    25   0.84 
EF222296-1|ABN79656.2|  403|Tribolium castaneum arginine vasopre...    24   1.1  
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    23   3.4  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    23   3.4  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    23   3.4  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    23   3.4  
AY362543-1|AAQ63455.1|  677|Tribolium castaneum chitin synthase ...    22   4.5  
AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ...    22   4.5  
AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ...    22   4.5  
AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor ...    22   5.9  

>AM292349-1|CAL23161.1|  248|Tribolium castaneum gustatory receptor
           candidate 28 protein.
          Length = 248

 Score = 24.6 bits (51), Expect = 0.84
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = +2

Query: 23  VNFYS*KIWNSLYDANFVGNVQCVIIS 103
           V+FY      S Y  NF G++Q +IIS
Sbjct: 110 VHFYYPVATMSFYVLNFFGSIQFIIIS 136


>EF222296-1|ABN79656.2|  403|Tribolium castaneum arginine
           vasopressin receptor protein.
          Length = 403

 Score = 24.2 bits (50), Expect = 1.1
 Identities = 11/30 (36%), Positives = 14/30 (46%)
 Frame = +2

Query: 497 PLIPSFWASVQSSIWKLLAWVWQFWLLLPQ 586
           PL    W S +S +   LAWV      +PQ
Sbjct: 145 PLTYCSWTSRRSKVMVYLAWVASLAFCIPQ 174


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
           variant 2 protein.
          Length = 1558

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = +2

Query: 551 AWVWQFWLL 577
           AW+W  WLL
Sbjct: 464 AWIWLLWLL 472


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
           variant 1 protein.
          Length = 1558

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = +2

Query: 551 AWVWQFWLL 577
           AW+W  WLL
Sbjct: 464 AWIWLLWLL 472


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase
           CHS1B protein.
          Length = 1558

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = +2

Query: 551 AWVWQFWLL 577
           AW+W  WLL
Sbjct: 464 AWIWLLWLL 472


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase
           CHS1A protein.
          Length = 1558

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = +2

Query: 551 AWVWQFWLL 577
           AW+W  WLL
Sbjct: 464 AWIWLLWLL 472


>AY362543-1|AAQ63455.1|  677|Tribolium castaneum chitin synthase
           protein.
          Length = 677

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = +2

Query: 551 AWVWQFWLL 577
           AW+W  WLL
Sbjct: 218 AWIWLVWLL 226


>AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase
           protein.
          Length = 1464

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = +2

Query: 551 AWVWQFWLL 577
           AW+W  WLL
Sbjct: 451 AWIWLVWLL 459


>AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase
           CHS2 protein.
          Length = 1464

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = +2

Query: 551 AWVWQFWLL 577
           AW+W  WLL
Sbjct: 451 AWIWLVWLL 459


>AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor
           protein protein.
          Length = 585

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 8/22 (36%), Positives = 10/22 (45%)
 Frame = -2

Query: 588 GCGNSSQNCQTQASSFQIEDCT 523
           G G   + C T A  F   DC+
Sbjct: 498 GNGRCDEECNTYACEFDGNDCS 519


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 137,916
Number of Sequences: 336
Number of extensions: 2717
Number of successful extensions: 20
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 20
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 19675845
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -