BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30598 (736 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory recept... 25 0.84 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 24 1.1 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 3.4 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 3.4 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 3.4 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 3.4 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 4.5 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 4.5 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 4.5 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 22 5.9 >AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory receptor candidate 28 protein. Length = 248 Score = 24.6 bits (51), Expect = 0.84 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 23 VNFYS*KIWNSLYDANFVGNVQCVIIS 103 V+FY S Y NF G++Q +IIS Sbjct: 110 VHFYYPVATMSFYVLNFFGSIQFIIIS 136 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 24.2 bits (50), Expect = 1.1 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +2 Query: 497 PLIPSFWASVQSSIWKLLAWVWQFWLLLPQ 586 PL W S +S + LAWV +PQ Sbjct: 145 PLTYCSWTSRRSKVMVYLAWVASLAFCIPQ 174 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.4 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +2 Query: 551 AWVWQFWLL 577 AW+W WLL Sbjct: 464 AWIWLLWLL 472 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.4 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +2 Query: 551 AWVWQFWLL 577 AW+W WLL Sbjct: 464 AWIWLLWLL 472 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.4 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +2 Query: 551 AWVWQFWLL 577 AW+W WLL Sbjct: 464 AWIWLLWLL 472 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.4 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +2 Query: 551 AWVWQFWLL 577 AW+W WLL Sbjct: 464 AWIWLLWLL 472 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 22.2 bits (45), Expect = 4.5 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +2 Query: 551 AWVWQFWLL 577 AW+W WLL Sbjct: 218 AWIWLVWLL 226 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.2 bits (45), Expect = 4.5 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +2 Query: 551 AWVWQFWLL 577 AW+W WLL Sbjct: 451 AWIWLVWLL 459 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.2 bits (45), Expect = 4.5 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +2 Query: 551 AWVWQFWLL 577 AW+W WLL Sbjct: 451 AWIWLVWLL 459 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/22 (36%), Positives = 10/22 (45%) Frame = -2 Query: 588 GCGNSSQNCQTQASSFQIEDCT 523 G G + C T A F DC+ Sbjct: 498 GNGRCDEECNTYACEFDGNDCS 519 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,916 Number of Sequences: 336 Number of extensions: 2717 Number of successful extensions: 20 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19675845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -