BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30597 (496 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 23 1.3 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 23 2.4 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 23 2.4 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 23 2.4 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 3.1 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 3.1 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 3.1 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 3.1 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 3.1 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 3.1 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 3.1 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 3.1 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 4.1 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 22 4.1 DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein ... 21 7.2 AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein ... 21 7.2 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 23.4 bits (48), Expect = 1.3 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +3 Query: 264 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQTPQT 371 +DEAE S+ G + QS I +VAR+ +T T Sbjct: 272 SDEAEPSSTSKKSGIVRSHQQSCINRVARETKTAGT 307 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.6 bits (46), Expect = 2.4 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = +3 Query: 309 RHQYCQSWILQVARQRQTPQTTCHSKS 389 RH ++W+ R + TPQ+ S++ Sbjct: 241 RHLERKAWVASFGRPKMTPQSLLPSQT 267 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.6 bits (46), Expect = 2.4 Identities = 14/48 (29%), Positives = 20/48 (41%) Frame = -3 Query: 275 SLVCSETMSKAYLSSKLDRNSCSF*SGNFSYQVCQSIQDGTCPC*FCD 132 S+V S+ +YL KL+RN + Q +C C CD Sbjct: 287 SVVVSDYSDYSYLDEKLERNDLDL--EKYEGISSTPSQASSCSCLDCD 332 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 22.6 bits (46), Expect = 2.4 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +1 Query: 250 DIVSEQTRLKYASAPDGKVPVI 315 D V EQT A D KVP+I Sbjct: 228 DGVKEQTLQSIEMAKDAKVPII 249 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +3 Query: 264 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 359 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +3 Query: 264 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 359 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +3 Query: 264 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 359 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +3 Query: 264 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 359 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +3 Query: 264 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 359 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +3 Query: 264 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 359 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +3 Query: 264 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 359 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +3 Query: 264 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 359 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.8 bits (44), Expect = 4.1 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -3 Query: 290 ADAYFSLVCSETMSKAYLSSKLDRNS 213 +D+ +S CS + S+ S + RNS Sbjct: 13 SDSGYSNTCSNSQSQRSSGSSISRNS 38 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 21.8 bits (44), Expect = 4.1 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -3 Query: 290 ADAYFSLVCSETMSKAYLSSKLDRNS 213 +D+ +S CS + S+ S + RNS Sbjct: 13 SDSGYSNTCSNSQSQRSSGSSISRNS 38 >DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein 4 protein. Length = 128 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/40 (20%), Positives = 20/40 (50%) Frame = -3 Query: 263 SETMSKAYLSSKLDRNSCSF*SGNFSYQVCQSIQDGTCPC 144 +E + AY++ LD+ C+ + + ++++ PC Sbjct: 39 TERLLNAYVNCLLDQGPCTPDAAELKRNLPDALENECSPC 78 >AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein protein. Length = 128 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/40 (20%), Positives = 20/40 (50%) Frame = -3 Query: 263 SETMSKAYLSSKLDRNSCSF*SGNFSYQVCQSIQDGTCPC 144 +E + AY++ LD+ C+ + + ++++ PC Sbjct: 39 TERLLNAYVNCLLDQGPCTPDAAELKRNLPDALENECSPC 78 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,703 Number of Sequences: 438 Number of extensions: 2649 Number of successful extensions: 16 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13667319 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -