BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30595 (774 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory pro... 28 0.095 DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory pro... 26 0.38 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 2.1 DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory pro... 22 4.7 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 21 8.3 >DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory protein 7 protein. Length = 127 Score = 27.9 bits (59), Expect = 0.095 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +1 Query: 28 ALRSICTKCQRNSLERIAKL*QLDSAKKMLNWKKIKKQ 141 AL S CTKC + E K+ + + K+ +W+++ K+ Sbjct: 69 ALSSGCTKCNQKQKETAEKVIRHLTQKRARDWERLSKK 106 >DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory protein 19 protein. Length = 119 Score = 25.8 bits (54), Expect = 0.38 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +1 Query: 28 ALRSICTKCQRNSLERIAKL*QLDSAKKMLNWKKI 132 AL+S C KC E K+ S K WK++ Sbjct: 65 ALKSDCAKCSEKQKEMTKKVIHFLSHNKQQMWKEL 99 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 548 PSQPLNKSICHVLKPRTLRSGFLS 619 P QP +K+ C L +T+R ++S Sbjct: 1100 PEQPPDKATCTTLTAQTIRVSWVS 1123 >DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory protein 13 protein. Length = 124 Score = 22.2 bits (45), Expect = 4.7 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +1 Query: 28 ALRSICTKCQRNSLERIAKL*QLDSAKKMLNWKKIKKQ 141 AL++ C KC E I K+ +K W++++K+ Sbjct: 65 ALKNECAKCNDKHKEGIRKVIHYLVKQKPEWWEQLQKK 102 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -1 Query: 540 KSFFRMSIYFRLSLSIARASSTVCAN 463 KSF R I+ ++ L + +S C N Sbjct: 54 KSFHRNEIHIKIVLMFFKEASLYCFN 79 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,443 Number of Sequences: 336 Number of extensions: 2418 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20857569 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -