BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30593 (839 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37698| Best HMM Match : Ribosomal_S3Ae (HMM E-Value=5e-21) 118 8e-27 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 95 6e-20 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 2e-17 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 5e-17 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 75 1e-13 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 74 2e-13 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 71 1e-12 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 71 2e-12 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 2e-12 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 70 2e-12 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 69 4e-12 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 69 4e-12 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 69 4e-12 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 69 5e-12 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 6e-12 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 69 6e-12 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 6e-12 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 6e-12 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 6e-12 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 69 6e-12 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 6e-12 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 6e-12 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 8e-12 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 8e-12 SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) 68 8e-12 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 68 8e-12 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 8e-12 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 68 1e-11 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 68 1e-11 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 68 1e-11 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 68 1e-11 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 68 1e-11 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 68 1e-11 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 68 1e-11 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 68 1e-11 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 68 1e-11 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 68 1e-11 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 68 1e-11 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 68 1e-11 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 68 1e-11 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) 68 1e-11 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 68 1e-11 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 68 1e-11 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 68 1e-11 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 68 1e-11 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 68 1e-11 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 68 1e-11 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 68 1e-11 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 68 1e-11 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 68 1e-11 SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_18654| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 68 1e-11 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 68 1e-11 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 68 1e-11 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 68 1e-11 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 68 1e-11 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 68 1e-11 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 68 1e-11 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_4190| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 68 1e-11 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 68 1e-11 SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 68 1e-11 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 68 1e-11 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 68 1e-11 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 68 1e-11 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 68 1e-11 SB_51352| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 68 1e-11 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_44512| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 68 1e-11 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 68 1e-11 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_31079| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_20651| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 68 1e-11 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_16729| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 68 1e-11 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 68 1e-11 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 68 1e-11 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 68 1e-11 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_969| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_51296| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 66 3e-11 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 66 3e-11 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 66 3e-11 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 66 3e-11 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 66 3e-11 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 66 3e-11 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 66 3e-11 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 66 3e-11 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 66 3e-11 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 66 3e-11 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 66 3e-11 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 66 3e-11 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 66 3e-11 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 66 3e-11 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 66 3e-11 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 66 3e-11 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 66 3e-11 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 66 3e-11 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 66 3e-11 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 66 3e-11 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 66 3e-11 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 66 3e-11 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 66 3e-11 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 66 3e-11 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 66 3e-11 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 66 3e-11 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 66 3e-11 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 66 3e-11 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 66 3e-11 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 66 3e-11 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 66 3e-11 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 66 3e-11 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 66 3e-11 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 66 3e-11 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 66 3e-11 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 >SB_37698| Best HMM Match : Ribosomal_S3Ae (HMM E-Value=5e-21) Length = 147 Score = 118 bits (283), Expect = 8e-27 Identities = 53/74 (71%), Positives = 66/74 (89%) Frame = +2 Query: 257 TQVRAIRKKMCEIITRDVTNSELREVVNKLIPDSIAKDIEKACHGIYPLRDVCIRKVKVL 436 TQ++AIRKKM +IITR+V+ ++L+EVVNKLIPDSI KDIEK+C IYPL DV IRKVKVL Sbjct: 42 TQIKAIRKKMVDIITREVSTNDLKEVVNKLIPDSIGKDIEKSCQSIYPLHDVHIRKVKVL 101 Query: 437 KRPRFEISKLMELH 478 K+P+F+I KLME+H Sbjct: 102 KKPKFDIGKLMEMH 115 Score = 58.8 bits (136), Expect = 5e-09 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = +3 Query: 138 TLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYAQTLRSEQSERKCV 290 TLIEA +DVKTTDGY+LR+FCIGFT + +KT YA+ + + +K V Sbjct: 2 TLIEAAVDVKTTDGYLLRMFCIGFTKRRQNQIKKTAYAKHTQIKAIRKKMV 52 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 95.1 bits (226), Expect = 6e-20 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = +1 Query: 667 LQRRDWENPGVTQLNRXAAHPPFASWLIAKRPHRSPFPTVAQLKWRM 807 LQRRDWENPGVTQLNR AAHPPFASW ++RPHRSPFPTVAQ +WRM Sbjct: 348 LQRRDWENPGVTQLNRLAAHPPFASWRNSERPHRSPFPTVAQPEWRM 394 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 87.4 bits (207), Expect = 1e-17 Identities = 44/51 (86%), Positives = 44/51 (86%), Gaps = 1/51 (1%) Frame = +2 Query: 659 PSFYNVVTGKTLALPNLIALQHIPLSPAG**R-RGPTDRPSQQLRS*NGEW 808 PSFYNVVTGKTLALPNLIALQHIPLSPAG R TDRPSQQLRS NGEW Sbjct: 87 PSFYNVVTGKTLALPNLIALQHIPLSPAGLHREEARTDRPSQQLRSLNGEW 137 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 59 NSCSPGDPLVLER 21 NSCSPGDPLVLER Sbjct: 55 NSCSPGDPLVLER 67 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 87.0 bits (206), Expect = 2e-17 Identities = 43/54 (79%), Positives = 46/54 (85%), Gaps = 1/54 (1%) Frame = +2 Query: 659 PSFYNVVTGKTLALPNLIALQHIPLSPAG-**RRGPTDRPSQQLRS*NGEWQIV 817 PSFYNVVTGKTLALPNLIALQHIPLSPAG TDRPSQQLRS NGEW+++ Sbjct: 7 PSFYNVVTGKTLALPNLIALQHIPLSPAGRNSEEARTDRPSQQLRSLNGEWRLM 60 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 85.4 bits (202), Expect = 5e-17 Identities = 43/51 (84%), Positives = 43/51 (84%), Gaps = 1/51 (1%) Frame = +2 Query: 659 PSFYNVVTGKTLALPNLIALQHIPLSPAG-**RRGPTDRPSQQLRS*NGEW 808 PSFYNVVTGKTLALPNLIALQHIPLSPAG TDRPSQQLRS NGEW Sbjct: 9 PSFYNVVTGKTLALPNLIALQHIPLSPAGVNSEEARTDRPSQQLRSLNGEW 59 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 82.6 bits (195), Expect = 4e-16 Identities = 42/50 (84%), Positives = 42/50 (84%), Gaps = 1/50 (2%) Frame = +2 Query: 662 SFYNVVTGKTLALPNLIALQHIPLSPAG-**RRGPTDRPSQQLRS*NGEW 808 SFYNVVTGKTLALPNLIALQHIPLSPAG TDRPSQQLRS NGEW Sbjct: 46 SFYNVVTGKTLALPNLIALQHIPLSPAGVIAEEARTDRPSQQLRSLNGEW 95 Score = 29.1 bits (62), Expect = 4.7 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = +1 Query: 622 IRPIVSRITIHW 657 +RP+VSRITIHW Sbjct: 33 LRPVVSRITIHW 44 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 80.6 bits (190), Expect = 1e-15 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +1 Query: 622 IRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 IRPIVSRITIHW +RRDWENPGV QLNR AAHPPFASW Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFASW 58 Score = 32.3 bits (70), Expect = 0.50 Identities = 21/51 (41%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = +2 Query: 659 PSFYNVVTGKTLALPNLIALQ-HIPLSPAG**RRGPTDRPSQQLRS*NGEW 808 PSFY + + L L H P + TDRPSQQLR NGEW Sbjct: 30 PSFYKRRDWENPGVNQLNRLAAHPPFASWRSSEEARTDRPSQQLRRLNGEW 80 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 79.0 bits (186), Expect = 4e-15 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = +1 Query: 634 VSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 +SRITIHW VLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 277 LSRITIHWPSVLQRRDWENPGVTQLNRLAAHPPFASW 313 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +2 Query: 764 TDRPSQQLRS*NGEW 808 TDRPSQQLRS NGEW Sbjct: 321 TDRPSQQLRSLNGEW 335 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 74.9 bits (176), Expect = 7e-14 Identities = 35/54 (64%), Positives = 38/54 (70%), Gaps = 2/54 (3%) Frame = -3 Query: 774 GRSVGP--LRY*PAGERGMCCXAIKLGNARVFPVTTL*NDGPVNCNTTHYRANW 619 GR++G PAGERGMCC AIKLGNA VFP + PVNCNTTHYRANW Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 Score = 50.8 bits (116), Expect = 1e-06 Identities = 28/53 (52%), Positives = 35/53 (66%), Gaps = 1/53 (1%) Frame = -2 Query: 811 LPFAISAAQLLGRAIG-GASSLLASWRKGDVLQXD*VG*RQGFPSHDVVKRRP 656 +PFAI AAQLLGRAIG G ++ + +G + +G FPSHDVVKRRP Sbjct: 3 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRP 55 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 23 ALELVDPPGCRNS 61 ALELVDPPGCRNS Sbjct: 75 ALELVDPPGCRNS 87 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 74.5 bits (175), Expect = 1e-13 Identities = 32/42 (76%), Positives = 33/42 (78%) Frame = -3 Query: 744 PAGERGMCCXAIKLGNARVFPVTTL*NDGPVNCNTTHYRANW 619 PAGERGMCC AIKLGNA VFP + PVNCNTTHYRANW Sbjct: 12 PAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 73.7 bits (173), Expect = 2e-13 Identities = 38/51 (74%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = +2 Query: 659 PSFYNVVTGKTLALPNLIALQHIPLSPAG**RRGPTD-RPSQQLRS*NGEW 808 PSFYNVVTGKTLALPNLIALQHIPLSPAG + P +QLRS NGEW Sbjct: 9 PSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPKQLRSLNGEW 59 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 73.3 bits (172), Expect = 2e-13 Identities = 38/51 (74%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Frame = +2 Query: 659 PSFYNVVTGKTLALPNLIALQHI-PLSPAG**RRGPTDRPSQQLRS*NGEW 808 PSFYNVVTGKTLALPNLIALQHI P + TDRPSQQLRS NGEW Sbjct: 9 PSFYNVVTGKTLALPNLIALQHIPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 72.9 bits (171), Expect = 3e-13 Identities = 31/42 (73%), Positives = 33/42 (78%) Frame = -3 Query: 744 PAGERGMCCXAIKLGNARVFPVTTL*NDGPVNCNTTHYRANW 619 PAGERGMCC AIKLGNA+ FP + PVNCNTTHYRANW Sbjct: 18 PAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 Score = 36.3 bits (80), Expect = 0.031 Identities = 18/30 (60%), Positives = 21/30 (70%), Gaps = 2/30 (6%) Frame = -1 Query: 791 CATVGKGDRWGLFAISQLAKGG--CAAXRL 708 CATVGKGDR GLFAI+ + G C A +L Sbjct: 2 CATVGKGDRCGLFAITPAGERGMCCKAIKL 31 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 72.1 bits (169), Expect = 5e-13 Identities = 32/48 (66%), Positives = 35/48 (72%) Frame = +1 Query: 601 RGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 RGG P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 43 RGGIGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 90 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 98 TDRPSQQLRSLNGEWRLM 115 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 70.9 bits (166), Expect = 1e-12 Identities = 31/48 (64%), Positives = 35/48 (72%) Frame = +1 Query: 601 RGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 +GG P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 51 QGGVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 98 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 106 TDRPSQQLRSLNGEWRLMRYFLL 128 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 70.5 bits (165), Expect = 2e-12 Identities = 35/73 (47%), Positives = 44/73 (60%), Gaps = 3/73 (4%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASWLIAKRPHRS-PFPTVAQL 795 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW ++ P + L Sbjct: 41 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 100 Query: 796 --KWRMANCKR*Y 828 +WR+ C + Y Sbjct: 101 NGEWRLMRCGQNY 113 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 70.5 bits (165), Expect = 2e-12 Identities = 36/51 (70%), Positives = 38/51 (74%), Gaps = 1/51 (1%) Frame = +2 Query: 659 PSFYNVVTGKTLALPNLIALQHIPL-SPAG**RRGPTDRPSQQLRS*NGEW 808 PSFYNVVTGKTLALPNL L+HIPL + TDRPSQQLRS NGEW Sbjct: 9 PSFYNVVTGKTLALPNLFDLRHIPLYASCTTSEEARTDRPSQQLRSLNGEW 59 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 70.1 bits (164), Expect = 2e-12 Identities = 34/71 (47%), Positives = 43/71 (60%), Gaps = 3/71 (4%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASWLIAKRPHRS-PFPTVAQL 795 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW ++ P + L Sbjct: 158 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 217 Query: 796 --KWRMANCKR 822 +WR+ C + Sbjct: 218 NGEWRLMRCDK 228 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 70.1 bits (164), Expect = 2e-12 Identities = 31/47 (65%), Positives = 34/47 (72%) Frame = +1 Query: 604 GGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 G +YP ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 17 GYIKYPPESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 63 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 71 TDRPSQQLRSLNGEWRLMRYFLL 93 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 69.3 bits (162), Expect = 4e-12 Identities = 35/74 (47%), Positives = 44/74 (59%), Gaps = 3/74 (4%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASWLIAKRPHRS-PFPTVAQL 795 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW ++ P + L Sbjct: 179 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 238 Query: 796 --KWRMANCKR*YF 831 +WR+ R Y+ Sbjct: 239 NGEWRLMRYMRDYY 252 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 69.3 bits (162), Expect = 4e-12 Identities = 31/47 (65%), Positives = 34/47 (72%) Frame = +1 Query: 604 GGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 G A P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 38 GDAGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 84 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 92 TDRPSQQLRSLNGEWRLMRYFLL 114 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 69.3 bits (162), Expect = 4e-12 Identities = 32/54 (59%), Positives = 37/54 (68%), Gaps = 2/54 (3%) Frame = -3 Query: 774 GRSVGP--LRY*PAGERGMCCXAIKLGNARVFPVTTL*NDGPVNCNTTHYRANW 619 GR++G PAGERGMCC +IKL +A VFP + PVNCNTTHYRANW Sbjct: 8 GRAIGAGLFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/49 (46%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Frame = -2 Query: 799 ISAAQLLGRAIG-GASSLLASWRKGDVLQXD*VG*RQGFPSHDVVKRRP 656 + AAQLLGRAIG G ++ + +G + + FPSHDVVKRRP Sbjct: 1 MQAAQLLGRAIGAGLFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRP 49 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 23 ALELVDPPGCRNS 61 ALELVDPPGCRNS Sbjct: 69 ALELVDPPGCRNS 81 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 69.3 bits (162), Expect = 4e-12 Identities = 35/53 (66%), Positives = 36/53 (67%), Gaps = 2/53 (3%) Frame = -3 Query: 774 GRSVGP--LRY*PAGERGMCCXAIKLGNARVFPVTTL*NDGPVNCNTTHYRAN 622 GRS+G PAGERGMCC AIKLGNAR FP PVNCNTTHYRAN Sbjct: 45 GRSIGAGLFAITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 Score = 31.5 bits (68), Expect = 0.88 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +1 Query: 7 TAVAXRSRTSGSPGLQEF 60 T+ RSRTSGSPGLQEF Sbjct: 101 TSGGGRSRTSGSPGLQEF 118 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/49 (63%), Positives = 34/49 (69%) Frame = +1 Query: 598 TRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 TR P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 54 TREACGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 102 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 110 TDRPSQQLRSLNGEWRLMRYFLL 132 >SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) Length = 152 Score = 68.9 bits (161), Expect = 5e-12 Identities = 34/50 (68%), Positives = 36/50 (72%), Gaps = 4/50 (8%) Frame = +1 Query: 607 GARYPIRPIVSRITIHW----AVVLQRRDWENPGVTQLNRXAAHPPFASW 744 G YP P SR + + AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 42 GLNYPFVPKSSRHSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASW 91 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +2 Query: 764 TDRPSQQLRS*NGEW 808 TDRPSQQLRS NGEW Sbjct: 99 TDRPSQQLRSLNGEW 113 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 68.9 bits (161), Expect = 5e-12 Identities = 31/49 (63%), Positives = 34/49 (69%) Frame = +1 Query: 598 TRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 TR P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 20 TRSTVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 68 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 76 TDRPSQQLRSLNGEWRLMRYFLL 98 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 68.9 bits (161), Expect = 5e-12 Identities = 36/51 (70%), Positives = 38/51 (74%), Gaps = 1/51 (1%) Frame = +2 Query: 659 PSFYNVVTGKTLALPNLIALQ-HIPLSPAG**RRGPTDRPSQQLRS*NGEW 808 PSFYNVVTGKTLALPNLIALQ H P + TDRPSQ+LRS NGEW Sbjct: 9 PSFYNVVTGKTLALPNLIALQLHPPFASWRNSEEARTDRPSQRLRSLNGEW 59 Score = 31.9 bits (69), Expect = 0.67 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +1 Query: 637 SRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 SRITIHW + + L HPPFASW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASW 37 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 68.5 bits (160), Expect = 6e-12 Identities = 31/48 (64%), Positives = 34/48 (70%) Frame = +1 Query: 601 RGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 RG P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 1 RGEYGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 48 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 56 TDRPSQQLRSLNGEWRLM 73 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 68.5 bits (160), Expect = 6e-12 Identities = 32/48 (66%), Positives = 35/48 (72%) Frame = +1 Query: 601 RGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 RGG P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 84 RGGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 129 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 137 TDRPSQQLRSLNGEWRLMRYFLL 159 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 68.5 bits (160), Expect = 6e-12 Identities = 30/44 (68%), Positives = 33/44 (75%) Frame = +1 Query: 613 RYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 R P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 94 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 137 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 145 TDRPSQQLRSLNGEWRLMRYFLL 167 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 68.5 bits (160), Expect = 6e-12 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +1 Query: 634 VSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 +SRIT AVVLQRRDWEN GVTQLNR AAHPPFASW Sbjct: 88 LSRITNSLAVVLQRRDWENTGVTQLNRLAAHPPFASW 124 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 132 TDRPSQQLRSLNGEWRLM 149 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 68.5 bits (160), Expect = 6e-12 Identities = 30/44 (68%), Positives = 33/44 (75%) Frame = +1 Query: 613 RYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 R P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 57 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 100 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 108 TDRPSQQLRSLNGEWRLMRYFLL 130 >SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) Length = 132 Score = 68.5 bits (160), Expect = 6e-12 Identities = 34/58 (58%), Positives = 39/58 (67%), Gaps = 3/58 (5%) Frame = +1 Query: 658 AVVLQRRDWENPGVTQLNRXAAHPPFASWLIAKRPHRS-PFPTVAQL--KWRMANCKR 822 AVVLQRRDWENPGVTQLNR AAHPPFASW ++ P + L +WR+ KR Sbjct: 52 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRTKR 109 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 68.5 bits (160), Expect = 6e-12 Identities = 30/44 (68%), Positives = 33/44 (75%) Frame = +1 Query: 613 RYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 R P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 7 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 50 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 58 TDRPSQQLRSLNGEWRLMRYFLL 80 >SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 68.5 bits (160), Expect = 6e-12 Identities = 30/44 (68%), Positives = 33/44 (75%) Frame = +1 Query: 613 RYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 R P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 10 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 53 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 61 TDRPSQQLRSLNGEWRLM 78 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 68.1 bits (159), Expect = 8e-12 Identities = 36/51 (70%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = +2 Query: 659 PSFYNVVTGKTLALPNLIAL-QHIPLSPAG**RRGPTDRPSQQLRS*NGEW 808 PSFYNVVTGKTLALPNLIAL H P + TDRPSQQLRS NGEW Sbjct: 9 PSFYNVVTGKTLALPNLIALAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = +1 Query: 637 SRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 SRITIHW + + L AAHPPFASW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASW 37 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 68.1 bits (159), Expect = 8e-12 Identities = 30/46 (65%), Positives = 33/46 (71%) Frame = +1 Query: 607 GARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 G P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 88 GVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 133 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 141 TDRPSQQLRSLNGEWRLMRYFLL 163 >SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) Length = 1036 Score = 68.1 bits (159), Expect = 8e-12 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 658 AVVLQRRDWENPGVTQLNRXAAHPPFASWL 747 AVVLQRRDWENPGVTQLNR AAHPPFASWL Sbjct: 143 AVVLQRRDWENPGVTQLNRLAAHPPFASWL 172 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 68.1 bits (159), Expect = 8e-12 Identities = 30/46 (65%), Positives = 33/46 (71%) Frame = +1 Query: 607 GARYPIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 G P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 703 GVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 748 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 756 TDRPSQQLRSLNGEWRLMRYFLL 778 >SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 68.1 bits (159), Expect = 8e-12 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 3/42 (7%) Frame = +1 Query: 628 PIVSRITIHW---AVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P++ R+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 50 PVMGRLESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASW 91 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +2 Query: 764 TDRPSQQLRS*NGEW 808 TDRPSQQLRS NGEW Sbjct: 99 TDRPSQQLRSLNGEW 113 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 91 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 99 TDRPSQQLRSLNGEWRLMRYFLL 121 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 13 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 54 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 62 TDRPSQQLRSLNGEWRLMRYFLL 84 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 78 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 86 TDRPSQQLRSLNGEWRLMRYFLL 108 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 57 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 65 TDRPSQQLRSLNGEWRLMRYFLL 87 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 45 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 53 TDRPSQQLRSLNGEWRLM 70 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 17 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 66 TDRPSQQLRSLNGEWRLM 83 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 47 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 55 TDRPSQQLRSLNGEWRLM 72 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 45 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 53 TDRPSQQLRSLNGEWRLM 70 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 821 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 862 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 870 TDRPSQQLRSLNGEWRLMRYFLL 892 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 45 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 53 TDRPSQQLRSLNGEWRLM 70 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 102 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 143 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 151 TDRPSQQLRSLNGEWRLMRYFLL 173 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 68 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 76 TDRPSQQLRSLNGEWRLMRYFLL 98 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 49 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 57 TDRPSQQLRSLNGEWRLM 74 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 66 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +2 Query: 764 TDRPSQQLRS*NGEW 808 TDRPSQQLRS NGEW Sbjct: 74 TDRPSQQLRSLNGEW 88 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 76 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 117 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 125 TDRPSQQLRSLNGEWRLMRYFLL 147 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 66 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 74 TDRPSQQLRSLNGEWRLM 91 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 120 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 161 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 169 TDRPSQQLRSLNGEWRLM 186 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 51 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 59 TDRPSQQLRSLNGEWRLMRYFLL 81 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 141 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 182 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 190 TDRPSQQLRSLNGEWRLMRYFLL 212 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 86 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 94 TDRPSQQLRSLNGEWRLMRYFLL 116 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 50 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 58 TDRPSQQLRSLNGEWRLM 75 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 48 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 89 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 97 TDRPSQQLRSLNGEWRLMRYFLL 119 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 45 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 53 TDRPSQQLRSLNGEWRLM 70 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 21 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 62 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 70 TDRPSQQLRSLNGEWRLM 87 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 36 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 77 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 85 TDRPSQQLRSLNGEWRLMRYFLL 107 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 28 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 69 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 77 TDRPSQQLRSLNGEWRLMRYFLL 99 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 63 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 104 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 112 TDRPSQQLRSLNGEWRLMRYFLL 134 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 51 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 59 TDRPSQQLRSLNGEWRLMRYFLL 81 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 86 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 94 TDRPSQQLRSLNGEWRLMRYFLL 116 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 88 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 129 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 137 TDRPSQQLRSLNGEWRLM 154 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 102 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 110 TDRPSQQLRSLNGEWRLMRYFLL 132 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 57 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 65 TDRPSQQLRSLNGEWRLMRYFLL 87 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 134 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 175 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 183 TDRPSQQLRSLNGEWRLM 200 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 47 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 88 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 96 TDRPSQQLRSLNGEWRLMRYFLL 118 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 76 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 117 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 125 TDRPSQQLRSLNGEWRLMRYFLL 147 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 1178 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 1219 Score = 38.3 bits (85), Expect = 0.008 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = -3 Query: 807 HSPFQLRNCWEGRSV 763 HSPF+LRNCWEGRSV Sbjct: 404 HSPFRLRNCWEGRSV 418 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 1227 TDRPSQQLRSLNGEWRLM 1244 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -1 Query: 749 ISQLAKGGCAAXRLSW 702 + QLAKGGCAA RLSW Sbjct: 424 LRQLAKGGCAARRLSW 439 Score = 32.7 bits (71), Expect = 0.38 Identities = 19/43 (44%), Positives = 22/43 (51%) Frame = +1 Query: 22 RSRTSGSPGLQEFGTRCSATSTAWTSQPISSGGWLKNGRLSSK 150 RSRTSGSPGLQEF +T I G L G + +K Sbjct: 450 RSRTSGSPGLQEFDGCTLYKGAHYTRMHIIQGCALYKGAMITK 492 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 20 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 61 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 69 TDRPSQQLRSLNGEWRLMRYFLL 91 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 113 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 154 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 162 TDRPSQQLRSLNGEWRLMRYFLL 184 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 65 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 106 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 114 TDRPSQQLRSLNGEWRLM 131 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 19 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 60 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 68 TDRPSQQLRSLNGEWRLM 85 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 45 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 53 TDRPSQQLRSLNGEWRLM 70 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 63 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 71 TDRPSQQLRSLNGEWRLM 88 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 24 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 65 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 73 TDRPSQQLRSLNGEWRLM 90 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 84 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 125 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 133 TDRPSQQLRSLNGEWRLMRYFLL 155 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 49 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 90 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 98 TDRPSQQLRSLNGEWRLMRYFLL 120 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 113 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 121 TDRPSQQLRSLNGEWRLMRYFLL 143 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 28 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 69 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 77 TDRPSQQLRSLNGEWRLM 94 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 113 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 121 TDRPSQQLRSLNGEWRLMRYFLL 143 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 113 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 121 TDRPSQQLRSLNGEWRLMRYFLL 143 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 50 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 58 TDRPSQQLRSLNGEWRLM 75 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 53 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 94 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 102 TDRPSQQLRSLNGEWRLMRYFLL 124 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 12 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 53 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 61 TDRPSQQLRSLNGEWRLMRYFLL 83 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 45 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 53 TDRPSQQLRSLNGEWRLM 70 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 12 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 53 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 61 TDRPSQQLRSLNGEWRLMRYFLL 83 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 31 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 72 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 80 TDRPSQQLRSLNGEWRLMRYFLL 102 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 64 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 105 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 113 TDRPSQQLRSLNGEWRLMRYFLL 135 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 55 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 96 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 104 TDRPSQQLRSLNGEWRLMRYFLL 126 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 79 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 120 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 128 TDRPSQQLRSLNGEWRLMRYFLL 150 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 70 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 78 TDRPSQQLRSLNGEWRLMRYFLL 100 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 1051 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 1092 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVN 826 TDRPSQQLRS NGEW+++ N Sbjct: 1100 TDRPSQQLRSLNGEWRLMRQN 1120 >SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 79 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 120 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 46 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 54 TDRPSQQLRSLNGEWRLM 71 >SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 49 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 19 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 60 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 68 TDRPSQQLRSLNGEWRLM 85 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 122 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 163 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 171 TDRPSQQLRSLNGEWRLMRYFLL 193 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 170 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 211 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 219 TDRPSQQLRSLNGEWRLMRYFLL 241 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 47 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 88 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 96 TDRPSQQLRSLNGEWRLMRYFLL 118 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 7 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 48 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 56 TDRPSQQLRSLNGEWRLM 73 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 134 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 175 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 183 TDRPSQQLRSLNGEWRLMRYFLL 205 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 87 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 95 TDRPSQQLRSLNGEWRLMRYFLL 117 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 104 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 145 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 153 TDRPSQQLRSLNGEWRLMRYFLL 175 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 11 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 52 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 60 TDRPSQQLRSLNGEWRLMRYFLL 82 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 640 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 681 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 689 TDRPSQQLRSLNGEWRLMRYFLL 711 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 68 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 76 TDRPSQQLRSLNGEWRLMRYFLL 98 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 149 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 190 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 198 TDRPSQQLRSLNGEWRLMRYFLL 220 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 35 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 76 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 84 TDRPSQQLRSLNGEWRLM 101 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 20 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 61 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 69 TDRPSQQLRSLNGEWRLM 86 >SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) Length = 135 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 93 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 134 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 51 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 59 TDRPSQQLRSLNGEWRLMRYFLL 81 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 87 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 95 TDRPSQQLRSLNGEWRLM 112 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 58 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 99 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 107 TDRPSQQLRSLNGEWRLMRYFLL 129 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 46 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 54 TDRPSQQLRSLNGEWRLM 71 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 48 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 89 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 97 TDRPSQQLRSLNGEWRLM 114 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 764 TDRPSQQLRS*NGE 805 TDRPSQQLRS NGE Sbjct: 32 TDRPSQQLRSLNGE 45 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 59 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 100 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 108 TDRPSQQLRSLNGEWRLMRYFLL 130 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 67 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 108 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 116 TDRPSQQLRSLNGEWRLMRYFLL 138 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 173 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 214 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 222 TDRPSQQLRSLNGEWRLMRYFLL 244 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 102 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 110 TDRPSQQLRSLNGEWRLMRYFLL 132 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 254 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 295 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 303 TDRPSQQLRSLNGEWRLMRYFLL 325 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 49 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 57 TDRPSQQLRSLNGEWRLM 74 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 63 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 71 TDRPSQQLRSLNGEWRLMRYFLL 93 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 58 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 99 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 107 TDRPSQQLRSLNGEWRLMRYFLL 129 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 92 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 133 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 141 TDRPSQQLRSLNGEWRLMRYFLL 163 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 51 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 92 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 100 TDRPSQQLRSLNGEWRLMRYFLL 122 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 102 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 110 TDRPSQQLRSLNGEWRLMRYFLL 132 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 46 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 54 TDRPSQQLRSLNGEWRLM 71 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 62 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 103 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 111 TDRPSQQLRSLNGEWRLMRYFLL 133 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 71 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 112 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 120 TDRPSQQLRSLNGEWRLMRYFLL 142 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 164 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 205 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 213 TDRPSQQLRSLNGEWRLMRYFLL 235 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 19 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 60 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 68 TDRPSQQLRSLNGEWRLMRYFLL 90 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 71 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 112 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 120 TDRPSQQLRSLNGEWRLMRYFLL 142 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 49 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 57 TDRPSQQLRSLNGEWRLM 74 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 78 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 86 TDRPSQQLRSLNGEWRLMRYFLL 108 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 102 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 110 TDRPSQQLRSLNGEWRLM 127 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 130 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 171 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 179 TDRPSQQLRSLNGEWRLM 196 >SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 57 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +2 Query: 764 TDRPSQQLRS*NGEW 808 TDRPSQQLRS NGEW Sbjct: 65 TDRPSQQLRSLNGEW 79 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 56 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 97 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 105 TDRPSQQLRSLNGEWRLMRYFLL 127 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 86 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 94 TDRPSQQLRSLNGEWRLMRYFLL 116 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 98 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 106 TDRPSQQLRSLNGEWRLMRYFLL 128 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 49 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 57 TDRPSQQLRSLNGEWRLM 74 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 45 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 53 TDRPSQQLRSLNGEWRLM 70 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 26 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 67 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 75 TDRPSQQLRSLNGEWRLMRYFLL 97 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 32 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 73 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 81 TDRPSQQLRSLNGEWRLMRYFLL 103 >SB_18654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 392 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 289 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 330 >SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 68 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/18 (72%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLR+ NGEW+++ Sbjct: 76 TDRPSQQLRTLNGEWRLM 93 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 91 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 99 TDRPSQQLRSLNGEWRLMRYFLL 121 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 69 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 110 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 118 TDRPSQQLRSLNGEWRLMRYFLL 140 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 75 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 116 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 124 TDRPSQQLRSLNGEWRLMRYFLL 146 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 26 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 67 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 75 TDRPSQQLRSLNGEWRLMRYFLL 97 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 38 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 79 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 87 TDRPSQQLRSLNGEWRLMRYFLL 109 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 78 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 86 TDRPSQQLRSLNGEWRLMRYFLL 108 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 70 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 78 TDRPSQQLRSLNGEWRLM 95 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 51 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 59 TDRPSQQLRSLNGEWRLM 76 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 49 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 57 TDRPSQQLRSLNGEWRLM 74 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 114 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 155 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 163 TDRPSQQLRSLNGEWRLMRYFLL 185 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 31 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 72 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 80 TDRPSQQLRSLNGEWRLM 97 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 98 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 106 TDRPSQQLRSLNGEWRLMRYFLL 128 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 47 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 55 TDRPSQQLRSLNGEWRLM 72 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 42 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 83 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 91 TDRPSQQLRSLNGEWRLMRYFLL 113 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 76 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 117 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 125 TDRPSQQLRSLNGEWRLMRYFLL 147 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 84 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 92 TDRPSQQLRSLNGEWRLMRYFLL 114 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 87 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 95 TDRPSQQLRSLNGEWRLM 112 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 49 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 57 TDRPSQQLRSLNGEWRLM 74 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 82 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 123 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 131 TDRPSQQLRSLNGEWRLMRYFLL 153 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 53 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 94 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 102 TDRPSQQLRSLNGEWRLMRYFLL 124 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 155 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 196 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 204 TDRPSQQLRSLNGEWRLMRYFLL 226 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 91 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 99 TDRPSQQLRSLNGEWRLM 116 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 30 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 71 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 79 TDRPSQQLRSLNGEWRLM 96 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 46 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 54 TDRPSQQLRSLNGEWRLM 71 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 21 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 62 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 70 TDRPSQQLRSLNGEWRLM 87 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 67 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 108 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 116 TDRPSQQLRSLNGEWRLMRYFLL 138 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 86 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 94 TDRPSQQLRSLNGEWRLMRYFLL 116 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 63 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 71 TDRPSQQLRSLNGEWRLM 88 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 93 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 134 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 142 TDRPSQQLRSLNGEWRLMRYFLL 164 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 34 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 75 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 83 TDRPSQQLRSLNGEWRLM 100 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 24 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 65 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 73 TDRPSQQLRSLNGEWRLMRYFLL 95 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 107 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 148 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 156 TDRPSQQLRSLNGEWRLMRYFLL 178 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 140 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 181 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 189 TDRPSQQLRSLNGEWRLMRYFLL 211 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 90 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 131 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 139 TDRPSQQLRSLNGEWRLMRYFLL 161 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 63 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 71 TDRPSQQLRSLNGEWRLMRYFLL 93 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 55 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 63 TDRPSQQLRSLNGEWRLM 80 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 84 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 92 TDRPSQQLRSLNGEWRLM 109 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 66 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 74 TDRPSQQLRSLNGEWRLMRYFLL 96 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 44 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 85 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 93 TDRPSQQLRSLNGEWRLM 110 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 144 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 185 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 193 TDRPSQQLRSLNGEWRLM 210 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 98 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 106 TDRPSQQLRSLNGEWRLMRYFLL 128 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 114 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 155 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 163 TDRPSQQLRSLNGEWRLMRYFLL 185 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 87 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 95 TDRPSQQLRSLNGEWRLM 112 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 77 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 118 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 126 TDRPSQQLRSLNGEWRLM 143 >SB_4190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 7 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 48 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 47 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 55 TDRPSQQLRSLNGEWRLM 72 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 55 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 63 TDRPSQQLRSLNGEWRLMRYFLL 85 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 73 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 114 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 122 TDRPSQQLRSLNGEWRLMRYFLL 144 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 32 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 73 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 81 TDRPSQQLRSLNGEWRLM 98 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 81 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 122 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 130 TDRPSQQLRSLNGEWRLMRYFLL 152 >SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 127 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 168 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +2 Query: 764 TDRPSQQLRS*NGEW 808 TDRPSQQLRS NGEW Sbjct: 176 TDRPSQQLRSLNGEW 190 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 133 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 174 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 182 TDRPSQQLRSLNGEWRLM 199 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 60 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 101 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 109 TDRPSQQLRSLNGEWRLMRYFLL 131 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 81 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 122 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 130 TDRPSQQLRSLNGEWRLMRYFLL 152 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 84 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 92 TDRPSQQLRSLNGEWRLM 109 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 95 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 136 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 144 TDRPSQQLRSLNGEWRLMRYFLL 166 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 45 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 53 TDRPSQQLRSLNGEWRLM 70 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 69 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 110 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 118 TDRPSQQLRSLNGEWRLMRYFLL 140 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 96 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 137 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 145 TDRPSQQLRSLNGEWRLMRYFLL 167 >SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 45 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 53 TDRPSQQLRSLNGEWRLM 70 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 294 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 335 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 343 TDRPSQQLRSLNGEWRLMRYFLL 365 >SB_51352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 51 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 92 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 18 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 59 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 67 TDRPSQQLRSLNGEWRLM 84 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 40 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 81 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 89 TDRPSQQLRSLNGEWRLMRYFLL 111 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 3 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 44 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 52 TDRPSQQLRSLNGEWRLMRYFLL 74 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 55 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 63 TDRPSQQLRSLNGEWRLMRYFLL 85 >SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 45 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 53 TDRPSQQLRSLNGEWRLM 70 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 44 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 85 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 93 TDRPSQQLRSLNGEWRLMRYFLL 115 >SB_44512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 13 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 54 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +2 Query: 764 TDRPSQQLRS*NGEW 808 TDRPSQQLRS NGEW Sbjct: 62 TDRPSQQLRSLNGEW 76 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 235 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 276 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 284 TDRPSQQLRSLNGEWRLMRYFLL 306 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 69 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 110 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 118 TDRPSQQLRSLNGEWRLMRYFLL 140 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 36 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 77 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 85 TDRPSQQLRSLNGEWRLMRYFLL 107 >SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 45 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 53 TDRPSQQLRSLNGEWRLM 70 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 12 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 53 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 61 TDRPSQQLRSLNGEWRLMRYFLL 83 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 192 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 233 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 241 TDRPSQQLRSLNGEWRLMRYFLL 263 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 51 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 92 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 100 TDRPSQQLRSLNGEWRLMRYFLL 122 >SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 47 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 55 TDRPSQQLRSLNGEWRLM 72 >SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 23 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 64 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 72 TDRPSQQLRSLNGEWRLM 89 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 517 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 558 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 566 TDRPSQQLRSLNGEWRLM 583 >SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 66 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 74 TDRPSQQLRSLNGEWRLM 91 >SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 45 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 53 TDRPSQQLRSLNGEWRLM 70 >SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 45 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 53 TDRPSQQLRSLNGEWRLM 70 >SB_31079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 7 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 48 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +2 Query: 764 TDRPSQQLRS*NGEW 808 TDRPSQQLRS NGEW Sbjct: 56 TDRPSQQLRSLNGEW 70 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 18 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 59 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 67 TDRPSQQLRSLNGEWRLMRYFLL 89 >SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 49 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 57 TDRPSQQLRSLNGEWRLMRYFLL 79 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 73 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 114 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 122 TDRPSQQLRSLNGEWRLMRYFLL 144 >SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 20 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 61 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 69 TDRPSQQLRSLNGEWRLMRYFLL 91 >SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 97 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 138 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 146 TDRPSQQLRSLNGEWRLMRYFLL 168 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 50 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 58 TDRPSQQLRSLNGEWRLMRYFLL 80 >SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 66 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 74 TDRPSQQLRSLNGEWRLMRYFLL 96 >SB_20651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 70 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +2 Query: 764 TDRPSQQLRS*NGEW 808 TDRPSQQLRS NGEW Sbjct: 78 TDRPSQQLRSLNGEW 92 >SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) Length = 567 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 186 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 227 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 235 TDRPSQQLRSLNGEWRLM 252 >SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 48 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 89 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIVSVNIL 832 TDRPSQQLRS NGEW+++ +L Sbjct: 97 TDRPSQQLRSLNGEWRLMRYFLL 119 >SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 45 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 53 TDRPSQQLRSLNGEWRLM 70 >SB_16729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 55 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +2 Query: 764 TDRPSQQLRS*NGEW 808 TDRPSQQLRS NGEW Sbjct: 63 TDRPSQQLRSLNGEW 77 >SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 619 PIRPIVSRITIHWAVVLQRRDWENPGVTQLNRXAAHPPFASW 744 P+ ++ AVVLQRRDWENPGVTQLNR AAHPPFASW Sbjct: 15 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASW 56 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 764 TDRPSQQLRS*NGEWQIV 817 TDRPSQQLRS NGEW+++ Sbjct: 64 TDRPSQQLRSLNGEWRLM 81 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,733,080 Number of Sequences: 59808 Number of extensions: 596065 Number of successful extensions: 11727 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11657 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2371447782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -