BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30593 (839 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 25 0.87 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 6.1 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 22 6.1 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 25.0 bits (52), Expect = 0.87 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 11 RWRXALELVDPPGCRNSAPGALQLPRHGPHNR*AQVD 121 RW E VDP GC N+ P L P Q D Sbjct: 394 RWFTYQETVDPAGC-NAGPAKYYLKSRDPERTPYQWD 429 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.2 bits (45), Expect = 6.1 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -1 Query: 467 STSRSRNGASSTLSPFGCKHRAEGRCHGRPS 375 S S+S+ + S++S + + G C RPS Sbjct: 22 SNSQSQRSSGSSISRNSNRSESSGYCGRRPS 52 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 22.2 bits (45), Expect = 6.1 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -1 Query: 467 STSRSRNGASSTLSPFGCKHRAEGRCHGRPS 375 S S+S+ + S++S + + G C RPS Sbjct: 22 SNSQSQRSSGSSISRNSNRSESSGYCGRRPS 52 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 240,693 Number of Sequences: 438 Number of extensions: 5149 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26945694 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -